Array ( [0] => Array ( [image_path] => entertainment/ [image_id] => 7174432 [name] => 1706542421Amrapali-Dubey-calls-BB-20-bias.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/bigg-boss-20-amrapali-dubey-questions-makers-over-alleged-tv-bias-asks-baaki-genres-ke-logon-ko-leke-kyun-aate-ho/ [pub_date] => 2026-09-18 17:41:29 [feed_source_id] => 339 [feed_id] => 86867925 [category_id] => 8 [feed_title] => Bigg Boss 20: Amrapali Dubey questions makers over alleged TV bias; asks, Baaki genres ke logon ko leke kyun aate ho? [feed_description] => Bigg Boss 20 has been witnessing discussions among contestants about screen time, visibility and representation inside the house. Amid the ongoing conversation, actress Amrapali Dubey questioned whether the makers of the reality show are more inclined towards television personalities despite bringing contestants from different entertainment backgrounds. During a recent conversation, Amrapali raised the issue of contestant representation and questioned why people from other genres are brought into the show if the makers are primarily interested in featuring television actors. She said, Toh aap aise bas kyun bula rahe ho? bol do na, TV waale log ka hi karna hai sabko. Itna hi TV-friendly hai toh TV ke hi logon ko leke aao, baaki genres ke logon ko leke kyun aate ho? Aasif Khan weighs in on contestant visibility Aasif Khan also joined the conversation and spoke about the audience's response to the housemates. He suggested that viewers are already supporting the contestants who are getting visibility and questioned the need for additional efforts to highlight those who may not be appearing as much. Aasif said, Hamare saath hi karna hai. Audience jab bada support kar rahi hai. Jo log nahi dikh rahe hain, unko dikhane ke liye Bigg Boss ko apni poori power lagani pad rahi hai. Jahan lagani hai, Bigg Boss ko sar se lekar idhar tak. Poori power lagani padegi, kyunki hum mein se toh saare dikh rahe hai, kisi ko bhi nahi bola gaya ki tum log nahi dikh rahe ho. Mehnat kar rahe hain, entertain kar rahe hain, hasa rahe hain, rula rahe hain public ko. The conversation comes amid a broader discussion inside the Bigg Boss 20 house about how contestants from different entertainment industries are represented on the reality show. Amrapali's comments specifically questioned the perceived preference for television personalities, while Aasif focused on the audience response to the contestants who are receiving screen time. It will be interesting to see if host Salman Khan will address this discussion and allegation on the coming Weekend Ka Vaar episodes. Also Read:Bigg Boss 20: Isha Rikhi says she faced physical, emotional and social cheating in relationship [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [1] => Array ( [image_path] => entertainment/ [image_id] => 7174431 [name] => 880169213Bhumi-620.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/bhumi-pednekar-turns-showstopper-for-nazranaa-at-new-york-fashion-week-in-red-lehenga/ [pub_date] => 2026-09-18 17:41:28 [feed_source_id] => 339 [feed_id] => 86867924 [category_id] => 8 [feed_title] => Bhumi Pednekar turns showstopper for Nazranaa at New York Fashion Week in red lehenga [feed_description] => Bhumi Pednekar has made her international runway debut at New York Fashion Week, taking the Indian fashion aesthetic to the global stage. The actress closed Nazranaas SS27 show, Samskriti 2.0, in New York, where she walked as the showstopper in a red velvet lehenga inspired by the Shri Ramakrishna Temple at Belur Math. Bhumi has previously walked several Indian fashion runways, and her appearance at New York Fashion Week marked a new addition to her fashion journey. For Nazranaas latest collection, she wore the Belur Math Lehenga, a design that draws inspiration from the architecture and philosophy of the Shri Ramakrishna Temple. According to the designer, the temple reflects the idea of universal faith by bringing together architectural influences associated with Hindu temples, mosques and churches. The same concept has been incorporated into the lehenga, which combines traditional Indian detailing with a contemporary runway presentation. The flared red velvet skirt featured intricate silver embroidery, shimmering embellishments and floral and traditional motifs across the silhouette. At the centre of the skirt was a swan motif, which holds particular significance in the design. According to the designer, the swan represents the Paramatman, or Supreme Self, and is featured at the heart of the emblem designed by Swami Vivekananda. Bhumi paired the skirt with a matching fitted blouse featuring a sweetheart neckline and delicate straps. She opted for a contemporary interpretation of the dupatta, styling the sheer red fabric in a cape-like drape around her arms, with the material trailing behind her as she walked the runway. View this post on Instagram A post shared by Nazranaa (@nazranaanj) The actress accessorised the ensemble with statement diamond jewellery, including a prominent necklace, stud earrings, a maang tikka and kadas. Her makeup featured a luminous base, defined eyes, rosy cheeks and glossy lips, while her hair was styled in middle-parted braids. With its traditional inspiration and contemporary styling, Bhumis NYFW appearance brought together elements of Indian design and runway fashion as she closed Nazranaas SS27 presentation. Also Read: Bhumi Pednekar raises voice against rising cases of rape and gender-based violence: It is becoming an accepted reality in our society [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [2] => Array ( [image_path] => entertainment/ [image_id] => 7174430 [name] => 1311042447620x450-18092026-27.jpg.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/exclusive-damini-chopra-on-her-play-jigsaw-you-will-never-guess-whats-going-to-happen-in-the-next-minute/ [pub_date] => 2026-09-18 17:41:27 [feed_source_id] => 339 [feed_id] => 86867923 [category_id] => 8 [feed_title] => EXCLUSIVE: Damini Chopra on her play Jigsaw, You will never guess whats going to happen in the next minute [feed_description] => After studying theatre in Harvard, Damini Chopra is now all set to showcase various shades of herself as an actor in the upcoming play Jigsaw, which is premiering in Mumbai on Sunday September 20. It is written and directed by Bharat Dabholkar, who is also her co-star. In an exclusive chat with Bollywood Hungama, Damini recalled the interesting events that led to her casting in the play. I had reached out to Bharat Dabholkar way back in 2019, she said. He is a theatre veteran, I was new to Bombay and I wanted to work with him. I had done theatre at Harvard. We met, it was a promising meeting but nothing came out of it. As an actor, you follow up a few times or few months and then when you dont get a positive response, you drop it. Hence, she wasnt in touch with Dabholkar for a few years. I kept doing my work. Randomly a few months back he called me and said that he is looking for a lead girl and I am just perfect for it. He said he remembered that I had once auditioned. I said that was so many years ago. So, thats how this happened, revealed Damini. The actor described the play saying, Jigsaw is a one-thrill a minute play. You will never guess whats going to happen in the next minute. You would think you have figured it out but then you will have to look again. Despite the play being serious in nature, Damini had good fun while rehearsing it. Dabholkar sir doesnt carry the weight of his seniority and that makes such a huge difference. He is a great director. He protects you a lot from a lot of hassles that happen on sets. He keeps you focused on your job. So, that really helps. What a lot of people dont know is that he is a really fun guy. Even though this is a thriller and a serious play, we were laughing half way through the rehearsals, she said. In suspense thrillers, there is a chance that spoilers can be revealed on social media. Touching upon this challenge, Damini said, As an actor, especially when you are doing a suspense and thriller, the challenge is not how much are you going to hide it. The challenge is that every time you watch me, you should enjoy it as much. There is very little you can do to stop spoilers on social media. But what I can do as an actor and what I aim for is that every time you watch me, you have to enjoy. To achieve this, Damini revealed that they have ensured that no two performances of Jigsaw would be the same. We have practiced various versions of the same scene, she said. You will watch one version. Then when you come for the next version, you will realize that I am doing it differently. Apart from the play, Damini is also excited for her next project, which is in the international zone. There is something very interesting on the horizon, which is westwards, she said. I have studied theatre in Harvard. So, I have a network there. I was just there and I have shot for something, which we would be able to talk about very soon. That is in a spy-thriller zone. I have seen so much of Rosamund Pike growing up that I am manifesting characters like her. I can also attribute that to my physical training. I am an aerial silk artist and gymnast. Along with acting, Damini Chopra is also involved in her NGO, which is working with the Government of Maharashtra to take AI to vernacular medium students studying in Hindi, Marathi and Urdu. Acting and NGO both are my dreams. I am just happy to live my dream and I am just going to continue doing that, she signed off. [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [3] => Array ( [image_path] => entertainment/ [image_id] => 7174429 [name] => 980392476Aishwarya-Rai-Bachchan-struts-again-at-Paris-Fashion-Week-news.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/aishwarya-rai-bachchan-struts-again-at-paris-fashion-week-loreals-le-defile-returns-with-star-studded-line-up/ [pub_date] => 2026-09-18 17:41:26 [feed_source_id] => 339 [feed_id] => 86867922 [category_id] => 8 [feed_title] => Aishwarya Rai Bachchan struts again at Paris Fashion Week: L'Oral's Le Dfil returns with star-studded line-up [feed_description] => L'Oral Paris is set to bring back its celebrated Le Dfil to Paris Fashion Week, with the ninth edition scheduled for 28th September 2026 at Place Joffre, right in front of the Eiffel Tower. This year's showcase will revolve around the theme Express Your Worth, spotlighting sisterhood, diversity and inclusion on a global stage. A major highlight of the event will be the return of L'Oral Paris ambassador Aishwarya Rai Bachchan to the Le Dfil runway. Her comeback is being positioned as a reflection of strength, individuality and confidence, reinforcing the brand's message of empowering women to define beauty on their own terms. Since its debut in 2017, Le Dfil has grown into a marquee platform that unites leading voices from fashion, beauty and entertainment. The 2026 roster features an international ensemble including Aishwarya Rai Bachchan, Simone Ashley, Marie Bochet, Viola Davis, Cara Delevingne, Jane Fonda, Bebe Vio Grandis, Luma Grothe, Kendall Jenner, Aja Naomi King, Eva Longoria and Andie MacDowell. Alongside the runway spectacle, L'Oral Paris will unveil its Runway Matte Collection, featuring five bold new shades of Infallible Matte Resistance Liquid Lipstick curated specifically for Indian skin tones. The hero shade, 423 Audacious Redworn by Aishwarya Rai Bachchan during Paris Fashion Weekwill take centre stage in the launch. To extend the Parisian beauty experience to Indian consumers, L'Oral Paris has partnered with Amazon as its online partner and Lifestyle Stores as its offline partner. The brand will also host its first-ever masterclass in Mumbai this October, offering creators and customers a behind-the-scenes look at the artistry behind Le Dfil and the new Runway Matte Collection. With Aishwarya's return to the runway and a focused push on inclusive shades, L'Oral is betting big on blending global glamour with local relevance making this year's Le Dfil as much about empowerment as it is about high fashion. Also Read: Aishwarya Rai Bachchan poses with brother Aditya and family in unseen Raksha Bandhan photo [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [4] => Array ( [image_path] => entertainment/ [image_id] => 7174428 [name] => 1135292481Mahhi-Vij-Mary-Kom-clash.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/bigg-boss-20-mahhi-vij-mary-kom-lock-horns-after-love-gill-provokes-boxer-over-ration-task-watch-promo/ [pub_date] => 2026-09-18 17:41:25 [feed_source_id] => 339 [feed_id] => 86867921 [category_id] => 8 [feed_title] => Bigg Boss 20: Mahhi Vij, Mary Kom lock horns after Love Gill provokes boxer over ration task, watch promo! [feed_description] => Bigg Boss 20 has begun, but the drama inside the house is already picking up pace. With groups taking shape and rivalries emerging among the contestants, Mahhi Vij and MC Mary Kom have now found themselves at the centre of an increasingly heated equation. A recently released promo hints at another confrontation between the two, this time over a task involving the house ration. The tension between Mahhi and Mary Kom began amid Mahhi's ongoing feud with Yung DSA. During the captaincy task, Mahhi chose not to support Yung despite their previously cordial equation. She explained her decision by pointing out that Yung had already served as the house captain and that other contestants should also get a fair opportunity to compete for the position. While Yung was disappointed by Mahhi's decision, the situation escalated after Mary Kom allegedly presented a different version of Mahhi's conversation to the other housemates. Mary also claimed that Mahhi had abused Yung, which further added to the tension between the contestants. Mahhi Vij struggles to name Mary Kom in ration task The latest promo takes the rivalry a step further. In the upcoming episode, Bigg Boss calls Mahhi Vij, Uditi Singh and Aashif Khan into the 2X room and gives them an opportunity to win 75 per cent of the house ration. However, the contestants are given a condition. To secure the ration, they must reduce or remove the 'Jeevandan' lifeline of one contestant. As the trio discusses the decision, Mahhi appears to struggle while taking Mary Kom's name. She is seen asking Uditi for the boxer's name while deciding whose lifeline should be affected. The moment appears to set the stage for another confrontation. Later in the promo, Love Gill is seen approaching Mary Kom and talking to her about the decision made during the task. His conversation with Mary seemingly provokes her, eventually leading to a verbal altercation between Mary and Mahhi. View this post on Instagram A post shared by JioHotstar Reality (@jiohotstarreality) The exchange adds another layer to the growing rivalry between the two contestants, who have already found themselves on opposite sides of multiple disagreements inside the house. Viewers take sides in Mahhi-Mary Kom clash Since the beginning of Bigg Boss 20, some viewers have also discussed Mary Kom's personality and her comments inside the house. In an earlier episode, while speaking to fellow contestants, Mary referred to herself as a legend and suggested that nobody could be better than her. The latest promo has once again triggered a discussion around her attitude among viewers. Several users in the comments section appeared to support Mahhi and praised her for standing up for herself during the confrontation. At the same time, some viewers criticised Mary Kom over what they perceived as an overly assertive attitude and a tendency to look down on other contestants. The reactions remain divided, but the promo suggests that the Mahhi Vij and Mary Kom rivalry is far from over. With the house dynamics changing rapidly, their equation could become one of the talking points of the ongoing season. Also Read:Bigg Boss 20: Amrapali Dubey questions makers over alleged TV bias; asks, Baaki genres ke logon ko leke kyun aate ho? [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [5] => Array ( [image_path] => entertainment/ [image_id] => 7174427 [name] => 395466197620x450-18092026-32.jpg.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/exclusive-meghna-gulzar-gave-me-a-character-that-had-real-weight-sharing-screen-space-with-kareena-kapoor-was-an-experience-says-upendra-chauhan-on-daayra/ [pub_date] => 2026-09-18 17:41:24 [feed_source_id] => 339 [feed_id] => 86867920 [category_id] => 8 [feed_title] => EXCLUSIVE: Meghna Gulzar gave me a character that had real weight; sharing screen space with Kareena Kapoor was an experience, says Upendra Chauhan on Daayra [feed_description] => As Meghna Gulzars Daayra hits cinemas today, actor Upendra Chauhan reflects on his experience of being part of the investigative drama, which stars Kareena Kapoor Khan and Prithviraj Sukumaran in the lead. Chauhan plays Vishal, a police officer in the film, and is part of the investigation at the centre of the story. Talking about his experience of working with Meghna Gulzar, Chauhan said, Meghna Gulzar gave me a character that had real weight. There was a lot to understand beneath the surface, and that made the process interesting for me as an actor. Meghna has a very specific understanding of her characters and the world she creates, and that really came through in the way she directed every scene. On sharing screen space with Kareena Kapoor Khan, he added, Sharing screen space with Kareena was an experience. She brings a certain intensity and instinct to her scenes, and being part of those moments was something I genuinely enjoyed. It was a great learning experience for me. Daayra explores crime, law, justice and punishment. The film marks the first on-screen collaboration between Kareena Kapoor Khan and Prithviraj Sukumaran, who play police officers in the story. For Chauhan, Daayra also marks another significant release in a busy 2026. Earlier this year, he was seen in Satrangi: Badle Ka Khel, which premiered on ZEE5 in May. The series features Chauhan alongside Anshuman Pushkar, Mahavash and Kumud Mishra. The actor has also been part of System and Kaptaan this year, adding to a slate that has seen him move between different characters and formats. With Daayra now in theatres, Chauhan adds a Meghna Gulzar directorial and a theatrical release to his 2026 body of work. Also Read: REVEALED: Heres why Karan Johar has been thanked in Daayra and Hrithik Roshan and Huma Qureshi in Vibe [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [6] => Array ( [image_path] => entertainment/ [image_id] => 7174414 [name] => 374457384SDK_6808.jpg [feed_url] => https://www.thehindu.com/entertainment/music/soundscapes-of-india-how-music-festivals-are-becoming-launchpads-for-indie-artistes/article71471027.ece [pub_date] => 2026-09-18 17:34:59 [feed_source_id] => 28 [feed_id] => 86867906 [category_id] => 8 [feed_title] => How music festivals are becoming launchpads for indie artistes [feed_description] => Soundscapes of India, held recently in Delhi, brought together musicians from across the country, offering a platform for discovery, collaboration and industry connections. [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [7] => Array ( [image_path] => entertainment/ [image_id] => 7174419 [name] => 1093644090hanuman-ansh-184311388-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/bollywood/story/neem-karoli-baba-prayagraj-house-draws-devotees-after-hanuman-ansh-2997577-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 17:22:34 [feed_source_id] => 7 [feed_id] => 86867911 [category_id] => 8 [feed_title] => Why Neem Karoli Baba devotees are flocking to this Prayagraj home after Hanuman Ansh [feed_description] => Why Neem Karoli Baba devotees are flocking to this Prayagraj home after Hanuman Ansh [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [8] => Array ( [image_path] => topnews/ [image_id] => 7174268 [name] => 9280791971411256-202609183946299.webp [feed_url] => https://bhaskarlive.in/others/marathi-film-gondhal-announced-as-indias-official-selection-for-99th-academy-awards-2142618 [pub_date] => 2026-09-18 17:08:34 [feed_source_id] => 715 [feed_id] => 86867661 [category_id] => 1 [feed_title] => Marathi film Gondhal announced as India's official selection for 99th Academy Awards [feed_description] => Digital Desk | Mumbai, Sep 18 (IANS) The Marathi language film Gondhal has been selected by the Film Federation of India as India's official entry for the upcoming 99th edition of the Academy Awards. The Film Federation of India made the announcement in Mumbai on Friday. There were 33 films in contention this year, and the jury picked Santosh Davakhars film to represent India in the Best International Film Category for the 99th Academy Awards. The film stars Kishor Kadam, Ishita Deshmukh, Yogesh Sohoni, Nishad Bhoir and Anuj Prabhu. It is set against the backdrop of the traditional Maharashtrian Gondhal ritual, a night-long folk performance involving music, dance and mythology. The other titles included the Diljit Dosanjh-starrer Main Vaapas Aaunga, Border 2 and the Ranveer Singh-starrer Dhurandhar franchise, Dug Dug, Haq, Bhamardo, 120 Bahadur, Sing Geetham, Tera Mera Nata, Ladoo, Ohh My Dog, Balan The Boy, Peddi, Irumudi, Khoonta, Gandhi Talks, Bison Kalaamadan, Shape of Momo, Governor, 2020 Delhi, Commando Vin Love Story, Pravas, Man Aatale Manaatle, Obsess, Egwa, Angh, Hanuman Ansh and Ikkis. It is the 4th Marathi film to represent India at the Academy Awards after Shwaas, Harishchandrachi Factory and Court. Prior to this, India's official entry for the Best International Feature Film category at the 98th Academy Awards was Neeraj Ghaywan's drama Homebound. The film starrer Vishal Jethwa and Ishaan Khatter. It subsequently made the 15-film Oscars shortlist for International Feature Film. The 99th Academy Awards, honouring films released during 2026, are scheduled for March 14, 2027, at the Dolby Theatre at Ovation Hollywood in Los Angeles. Conan OBrien is set to return as host for the 3rd consecutive year. The eligibility period runs from January 1 through December 31, 2026, while nominations are scheduled to be announced on January 21, 2027. The ceremony will precede the Oscars centenary celebration in 2028, when the 100th Academy Awards will be held. [provider_name] => bhaskarlive [provider_slugname] => bhaskarlive [source_icon] => source_logo/Bhaskar-Live.png ) [9] => Array ( [image_path] => entertainment/ [image_id] => 7174426 [name] => 665270933gondhal-3-1789731031.webp [feed_url] => https://www.indiatvnews.com/entertainment/news/marathi-film-gondhal-is-india-s-oscar-2027-entry-know-plot-cast-box-office-collection-imdb-rating-and-more-2026-09-18-1054631 [pub_date] => 2026-09-18 17:08:27 [feed_source_id] => 125 [feed_id] => 86867918 [category_id] => 8 [feed_title] => Marathi film Gondhal is India's Oscar 2027 entry; know plot, cast, box office, IMDb rating and more [feed_description] => Marathi film Gondhal has been chosen as India's official entry for the Oscars 2027. The Film Federation of India (FFI) announced the selection on September 18. Written and directed by Santosh Davakhar, the thriller was selected from 33 films that were in contention this year. Gondhal will now represent India in the Best International Feature Film category at the Oscars. [provider_name] => India TV [provider_slugname] => indiatvnews [source_icon] => source_logo/IndiaTV.jpg ) [10] => Array ( [image_path] => entertainment/ [image_id] => 7174408 [name] => 365129759msid-134334067,imgsize-169246.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/sundeep-kishan-defends-sigma-co-star-faria-abdullah-after-success-ratio-questions-she-has-done-so-much-by-25/articleshow/134334052.cms [pub_date] => 2026-09-18 17:04:36 [feed_source_id] => 3 [feed_id] => 86867882 [category_id] => 8 [feed_title] => Sundeep Kishan defends Sigma co-star Faria Abdullah after success questions [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [11] => Array ( [image_path] => entertainment/ [image_id] => 7174409 [name] => 468443144msid-134333897,imgsize-511811.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/when-a-woman-says-no-its-never-taken-as-no-radhika-apte-says-she-was-really-taken-aback-revisiting-old-shah-rukh-khan-films-as-a-teenager-and-their-portrayal-of-romance/articleshow/134333809.cms [pub_date] => 2026-09-18 16:58:47 [feed_source_id] => 3 [feed_id] => 86867883 [category_id] => 8 [feed_title] => Radhika Apte says she was 'really taken aback' revisiting old SRK films [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [12] => Array ( [image_path] => entertainment/ [image_id] => 7174420 [name] => 62939522city-lights-review-181222143-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/reviews/story/city-lights-review-duniya-vijay-bengaluru-crime-drama-formulaic-2997705-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 16:48:29 [feed_source_id] => 7 [feed_id] => 86867912 [category_id] => 8 [feed_title] => City Lights review: Duniya Vijay's raw thriller let down by formulaic writing [feed_description] => City Lights review: Duniya Vijay's raw thriller let down by formulaic writing [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [13] => Array ( [image_path] => cities/ [image_id] => 7174168 [name] => 379844829hj.jpg [feed_url] => https://www.thehindu.com/entertainment/movies/happy-journey-movie-review-a-well-intentioned-yet-clumsy-all-women-holiday-film/article71480402.ece [pub_date] => 2026-09-18 16:43:50 [feed_source_id] => 28 [feed_id] => 86867509 [category_id] => 75 [feed_title] => Happy Journey movie review: A well-intentioned yet clumsy all-women holiday film [feed_description] => Directed by Abhiramm Naidu, this European road trip Telugu film means well but struggles to shake off its old-fashioned undertones [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [14] => Array ( [image_path] => entertainment/ [image_id] => 7174421 [name] => 1153787357raaka-allu-arjun--atlees-sci-fi-epic-unveils-cryptic-global-triumph-teaser-180708453-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/regional-cinema/story/raaka-allu-arjun-atlees-sci-fi-epic-unveils-cryptic-global-triumph-teaser-2997645-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 16:37:31 [feed_source_id] => 7 [feed_id] => 86867913 [category_id] => 8 [feed_title] => Raaka: Allu Arjun, Atlee's sci-fi epic unveils cryptic 'global triumph' teaser [feed_description] => Raaka: Allu Arjun, Atlee's sci-fi epic unveils cryptic 'global triumph' teaser [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [15] => Array ( [image_path] => entertainment/ [image_id] => 7174410 [name] => 1481538447msid-134333232,imgsize-126629.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/telugu/movies/news/suhas-addresses-mandaadi-success-meet-controversy-with-heartfelt-note-to-telugu-fans-you-supported-me-at-every-step/articleshow/134333213.cms [pub_date] => 2026-09-18 16:30:07 [feed_source_id] => 3 [feed_id] => 86867884 [category_id] => 8 [feed_title] => Suhas addresses Mandaadi success meet controversy, respects Telugu fans [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [16] => Array ( [image_path] => entertainment/ [image_id] => 7174411 [name] => 373949338msid-134333155,imgsize-94969.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/pa-ranjiths-vettuvam-glimpse-out-arya-attakathi-dinesh-sobhita-dhulipala-lead-a-dark-world-of-power-blood-and-survival-in-the-filmmakers-long-awaited-film/articleshow/134333124.cms [pub_date] => 2026-09-18 16:26:05 [feed_source_id] => 3 [feed_id] => 86867887 [category_id] => 8 [feed_title] => 'Vettuvam' glimpse unveils a dark world of power, blood, and survival [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [17] => Array ( [image_path] => topnews/ [image_id] => 7174108 [name] => 2097805445Hollywood-actor.jpg [feed_url] => https://www.siasat.com/11-hollywood-stars-who-pledged-to-boycott-israeli-film-groups-3543984/ [pub_date] => 2026-09-18 16:25:45 [feed_source_id] => 418 [feed_id] => 86867425 [category_id] => 1 [feed_title] => 11 Hollywood stars who pledged to boycott Israeli film groups [feed_description] => Hyderabad: Several prominent Hollywood stars are once again grabbing attention after their names featured on a 2025 pledge organised by Film Workers for Palestine. The signatories vowed not to screen films, appear at events or work with Israeli film institutions they consider implicated in genocide and apartheid against Palestinians. The campaign specifically targets institutions such Get the latest updates in Hyderabad City News , Technology , Entertainment , Sports , Politics and Top Stories on WhatsApp & Telegram by subscribing to our channels. You can also download our app for Android and iOS . [provider_name] => The Siasat Daily [provider_slugname] => siasat [source_icon] => source_logo/siasat.png ) [18] => Array ( [image_path] => entertainment/ [image_id] => 7174422 [name] => 1747922077vettuvam-glimpse-184852530-16x9_0.jpeg [feed_url] => https://www.indiatoday.in/movies/regional-cinema/story/vettuvam-teaser-pa-ranjith-arya-sobhita-dhulipala-mallakhamba-sci-fi-drama-2997680-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 16:21:23 [feed_source_id] => 7 [feed_id] => 86867914 [category_id] => 8 [feed_title] => Vettuvam glimpse: Pa Ranjith teases a dystopian world of sport, power and survival [feed_description] => Vettuvam glimpse: Pa Ranjith teases a dystopian world of sport, power and survival [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [19] => Array ( [image_path] => entertainment/ [image_id] => 7174415 [name] => 518955352ranveerdeepikasiddhivinayaktemple-1789728382507_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/deepika-padukone-and-ranveer-singh-siddhivinayak-temple-ritual-ahead-of-second-baby-23650656 [pub_date] => 2026-09-18 16:17:25 [feed_source_id] => 182 [feed_id] => 86867907 [category_id] => 8 [feed_title] => Deepika-Ranveer repeat their Siddhivinayak Temple ritual ahead of second baby [feed_description] => Pregnant Deepika Padukone and Ranveer Singh were seen repeating their ritual by visiting Mumbai's Siddhivinayak Temple ahead of welcoming their second child. The couple had earlier visited the temple days before the birth of their first child, daughter Dua in 2024 [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [20] => Array ( [image_path] => topnews/ [image_id] => 7174199 [name] => 1147668417msid-134332897,imgsize-363246.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/marathi/movies/marathi-film-gondhal-selected-as-indias-official-entry-for-oscars-2027-by-film-federation-chosen-from-33-contenders/articleshow/134332821.cms [pub_date] => 2026-09-18 16:16:46 [feed_source_id] => 3 [feed_id] => 86867553 [category_id] => 1 [feed_title] => Marathi film 'Gondhal' selected as India's official entry for the Oscars 2027 [feed_description] => The Marathi film 'Gondhal' has been selected to represent India at the 99th Academy Awards. Set against the backdrop of a traditional ritual in rural Maharashtra, this film was chosen from a pool of thirty-three entries by the selection committee. Notably, it is the fourth Marathi film to earn an Oscar nomination, with the ceremony scheduled for March 14, 2027. [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [21] => Array ( [image_path] => entertainment/ [image_id] => 7174416 [name] => 1202221935cnzdxghawrt-1789727061324_d.png [feed_url] => https://www.mid-day.com/entertainment/web-series/article/dupahiya-season-2-brings-dhadakpur-back-with-more-chaos-on-october-1-23650660 [pub_date] => 2026-09-18 16:13:50 [feed_source_id] => 182 [feed_id] => 86867908 [category_id] => 8 [feed_title] => Dupahiya season 2 brings Dhadakpur back with more chaos on October 1 [feed_description] => Dupahiya Season 2 premieres on October 1, returning to the fictional village of Dhadakpur with more small-town chaos, fresh challenges and unexpected twists. Gajraj Rao, Renuka Shahane, Sparsh Shrivastava and the ensemble return, while Bhojpuri actor-singer Nirahua joins the cast [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [22] => Array ( [image_path] => entertainment/ [image_id] => 7174417 [name] => 463471745dfbrfhrtdyawr-1789725015771_d.png [feed_url] => https://www.mid-day.com/entertainment/web-series/article/musafiri-trailer-richa-chadha-explores-the-mumbai-she-thought-she-knew-23650653 [pub_date] => 2026-09-18 16:12:55 [feed_source_id] => 182 [feed_id] => 86867909 [category_id] => 8 [feed_title] => Musafiri trailer: Richa Chadha explores the Mumbai she thought she knew [feed_description] => The trailer of Musafiri introduces Richa Chadha as she explores Mumbai through its lesser-known histories, people, places and stories. The eight-episode series takes her beyond familiar landmarks to discover the city with fresh eyes. It premieres September 25 [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [23] => Array ( [image_path] => entertainment/ [image_id] => 7174418 [name] => 1211328588gfcbdqwerew-1789723505186_d.png [feed_url] => https://www.mid-day.com/entertainment/web-series/article/unaccustomed-earth-first-look-freida-pinto-siddharth-lead-jhumpa-lahiri-adaptation-23650648 [pub_date] => 2026-09-18 16:11:20 [feed_source_id] => 182 [feed_id] => 86867910 [category_id] => 8 [feed_title] => Unaccustomed Earth: Freida Pinto, Siddharth lead Jhumpa Lahiri adaptation [feed_description] => The first look of Unaccustomed Earth has been unveiled, starring Freida Pinto and Siddharth in the lead. Adapted from Jhumpa Lahiris acclaimed short story collection, the family drama follows an Indian American community navigating love, loss, relationships and belonging [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [24] => Array ( [image_path] => topnews/ [image_id] => 7174118 [name] => 307277335Jenjum20Gadi205.JPG [feed_url] => https://www.thehindu.com/entertainment/art/artist-jenjum-gadi-bridges-galo-heritage-and-modern-art-in-his-new-show-in-delhi/article71467627.ece [pub_date] => 2026-09-18 16:08:09 [feed_source_id] => 28 [feed_id] => 86867440 [category_id] => 1 [feed_title] => Artist Jenjum Gadi bridges Galo heritage and modern art in his new show in Delhi [feed_description] => Fashion designer-turned-artist Jenjum Gadi returns to his Galo roots in a new show, turning food crops, memories and Nnature into sculpture [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [25] => Array ( [image_path] => topnews/ [image_id] => 7174117 [name] => 1695389246Jenjum20Gadi205.JPG [feed_url] => https://www.thehindu.com/entertainment/art/artist-jenjum-gadi-bridges-galo-heritage-and-modern-art-in-his-new-show-in-delhi/article71467627.ece [pub_date] => 2026-09-18 16:08:09 [feed_source_id] => 28 [feed_id] => 86867439 [category_id] => 1 [feed_title] => Artist Jenjum Gadi bridges Galo heritage and modern art in his new show in Delhi [feed_description] => Fashion designer-turned-artist Jenjum Gadi returns to his Galo roots in a new show, turning food crops, memories and Nnature into sculpture [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [26] => Array ( [image_path] => entertainment/ [image_id] => 7174423 [name] => 1108567984ranveer-singh--deepika-padukone-183024730-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/celebrities/story/deepika-padukone-ranveer-singh-visit-siddhivinayak-pregnant-2997678-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 16:00:39 [feed_source_id] => 7 [feed_id] => 86867915 [category_id] => 8 [feed_title] => Pregnant Deepika Padukone joins Ranveer as family seeks blessings at Siddhivinayak [feed_description] => Pregnant Deepika Padukone joins Ranveer as family seeks blessings at Siddhivinayak [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [27] => Array ( [image_path] => topnews/ [image_id] => 7174045 [name] => 69919274880968_16_9_2026_13_37_54_1_7O3A4382.JPEG [feed_url] => https://www.thehindu.com/entertainment/movies/safar-sanal-credits-urvashis-pivotal-role-in-aasha-praising-her-powerful-performance/article71472058.ece [pub_date] => 2026-09-18 15:59:13 [feed_source_id] => 28 [feed_id] => 86867288 [category_id] => 1 [feed_title] => Aasha director Safar Sanal: This film would not have been made without Urvashi [feed_description] => The debutant director talks about the making of the film and the experience of watching the veteran actor turn out one of her career-best performances [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [28] => Array ( [image_path] => entertainment/ [image_id] => 7174412 [name] => 2142824670msid-134332063,imgsize-145825.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/mandaadi-director-mathimaran-praises-mahima-nambiar-for-returning-to-shoot-six-days-after-surgery-following-accident-and-20-stitches-says-i-am-truly-thankful-to-her/articleshow/134332050.cms [pub_date] => 2026-09-18 15:54:49 [feed_source_id] => 3 [feed_id] => 86867891 [category_id] => 8 [feed_title] => 'Mandaadi' director Mathimaran praises Mahima Nambiar's effort [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [29] => Array ( [image_path] => topnews/ [image_id] => 7174044 [name] => 259640918gondhal-1789726380.webp [feed_url] => https://www.indiatvnews.com/entertainment/news/marathi-film-gondhal-selected-as-india-s-official-entry-for-oscars-2027-2026-09-18-1054619 [pub_date] => 2026-09-18 15:48:06 [feed_source_id] => 125 [feed_id] => 86867283 [category_id] => 1 [feed_title] => Marathi film Gondhal selected as India's official entry for Oscars 2027 [feed_description] => Marathi film Gondhal has been selected as Indias official entry for the Academy Awards, popularly known as the Oscars 2027. [provider_name] => India TV [provider_slugname] => indiatvnews [source_icon] => source_logo/IndiaTV.jpg ) [30] => Array ( [image_path] => entertainment/ [image_id] => 7174424 [name] => 843082104nani-on-pan-india-tag-181136930-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/regional-cinema/story/nani-questions-pan-india-tag-for-south-films-cites-jawan-pathaan-2997636-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 15:47:08 [feed_source_id] => 7 [feed_id] => 86867916 [category_id] => 8 [feed_title] => Hindi films aren't called pan-India, why only South? Nani questions double standards [feed_description] => Hindi films aren't called pan-India, why only South? Nani questions double standards [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [31] => Array ( [image_path] => entertainment/ [image_id] => 7174413 [name] => 1121318147msid-134332224,imgsize-150056.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/i-was-two-inches-taller-than-the-actor-playing-lord-rama-dev-sharma-reveals-being-rejected-as-lakshman-in-ranbir-kapoors-ramayana-due-to-height-difference-and-in-prabhas-adipurush/articleshow/134331438.cms [pub_date] => 2026-09-18 15:44:31 [feed_source_id] => 3 [feed_id] => 86867894 [category_id] => 8 [feed_title] => I was two inches taller: Dev Sharma was rejected in Ranbir Kapoor's 'Ramayana' [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [32] => Array ( [image_path] => entertainment/ [image_id] => 7174425 [name] => 1619463905marathi-film-gondhal-selected-as-indias-official-entry-for-99th-academy-awards-182217814-16x9_1.jpg [feed_url] => https://www.indiatoday.in/movies/story/marathi-film-gondhal-selected-as-indias-official-entry-for-99th-academy-awards-2997660-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 15:41:18 [feed_source_id] => 7 [feed_id] => 86867917 [category_id] => 8 [feed_title] => Marathi film Gondhal beats Dhurandhar, Hanuman Ansh to become India's Oscars entry [feed_description] => Marathi film Gondhal beats Dhurandhar, Hanuman Ansh to become India's Oscars entry [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [33] => Array ( [image_path] => entertainment/ [image_id] => 7173994 [name] => 843884499Daayra-620.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/kareena-kapoor-khan-says-ajooni-from-daayra-breaks-the-female-cop-stereotype-she-isnt-someone-who-resorts-to-guns-challenge-hona-bahut-zaroori-hota-hai/ [pub_date] => 2026-09-18 15:41:17 [feed_source_id] => 339 [feed_id] => 86867159 [category_id] => 8 [feed_title] => Kareena Kapoor Khan says Ajooni from Daayra breaks the female cop stereotype: She isn't someone who resorts to guns challenge hona bahut zaroori hota hai [feed_description] => Kareena Kapoor Khan has described her role as police officer Ajooni in Daayra as a different shade in her career. Directed by Meghna Gulzar, the film explores the conflict between the law and the delivery of justice, placing its characters in situations where the line between right and wrong is not always clear. The film stars Kareena and Prithviraj Sukumaran as police officers who find themselves on opposing sides while investigating a case set against the backdrop of juvenile crime. According to the makers, Daayra is inspired by true events. Speaking about the moral conflict at the centre of the story, Kareena referred to a line written by Gulzar. Jaise Gulzar Sahab ne likha tha in the song, 'sach ka daayra toh badalte rehta hai, she said, explaining the challenge of remaining aligned with Ajooni's perspective. It was difficult for me also to stay on track with Ajooni because there is always going to be a conflict. Im sure as a director Meghna felt that while writing it, Im sure Prithviraj's character, Raman, has felt that. So, it is very difficult, she added. Kareena said that while she personally prefers clarity, the film operates in a morally grey space. But as a person, I walk the straight line. I like to believe in life that it's black and white. But in the film, it is grey. That is for sure, she said. Ajooni's character also moves away from the conventional portrayal of female police officers in Hindi cinema. Kareena said the role was conceived as feminine, composed and firm rather than centred around action sequences. There has traditionally been a stereotypical format for female cops where she has to be butch, walk in a certain masculine way, and pick up a gun to do high-octane action, Kareena said. According to the actor, Meghna wanted Ajooni to be unapologetically feminine, while remaining firm in her principles. Ajooni isn't someone who resorts to guns and typical action heroics; that is simply not her character, she said. Meghna Gulzar explained that the film's central conflict comes from the overlap between the strict interpretation of law and the pursuit of justice. The moral conundrum overlaps on both ends, the strict letter of the law versus the delivery of justice, she said. The filmmaker added that although law, justice, crime and punishment appear as recurring themes in her work, her primary interest is the human aspect of such stories. It is purely coincidence; it is not by design. What attracts me to a story is the human quotient, what happens to the human emotion in that circumstance, she said. Prithviraj, who plays DCP Raman Kumar, also highlighted the film's grey zone. I don't agree with the entirety of Raman's actions, nor do I completely disagree with him, and the same applies to Ajooni, he said. The actor added that his decision to be part of Daayra was influenced by the larger issue explored by the story. Certain stories stand for a cause far larger than individual actors, and Daayra is one of them, Prithviraj said. Kareena Kapoor Says Ajooni Breaks the Stereotype of Female Cops in Daayra Kareena also compared the film with her association with Rohit Shetty's cop universe, describing the two approaches as distinct. Every director operates in a different universe, she said, calling Shetty's world larger-than-life and Meghna's grounded, realistic, and complex. As an actor, I feel fortunate to straddle both worlds comfortably, Kareena added. Reflecting on her career, Kareena said experimenting with different roles continues to be important to her after 25 years in the industry. I think as an actor, challenge hona bahut zaroori hota hai, especially after 25 years of work, she said. She also described playing Ajooni as an honour and said the character represents a different shade in her filmography. Daayra is set to release in theatres on September 18. The film follows the aftermath of a crime that sparks public outrage and sets two investigations in motion. Kareena and Prithviraj's characters navigate the same system through different approaches to duty and justice, as the case challenges conventional ideas of right and wrong. Also Read: REVEALED: Heres why Karan Johar has been thanked in Daayra and Hrithik Roshan and Huma Qureshi in Vibe [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [34] => Array ( [image_path] => entertainment/ [image_id] => 7173993 [name] => 2035992361620x450-18092026-23.jpg.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/shalini-pandey-pens-heartfelt-birthday-note-for-shabana-azmi-youre-sunshine/ [pub_date] => 2026-09-18 15:41:16 [feed_source_id] => 339 [feed_id] => 86867158 [category_id] => 8 [feed_title] => Shalini Pandey pens heartfelt birthday note for Shabana Azmi: Youre sunshine [feed_description] => Shalini Pandey shared a heartfelt birthday note for veteran actress Shabana Azmi, giving a glimpse into the bond the two share. Taking to her Instagram Story, Shalini posted a picture with Shabana and described her as the coolest person, while expressing gratitude for having someone she can speak to about anything and every thing, have fun with and continue to look up to. Sharing her birthday wishes, Shalini wrote, Happiest birthday to the coolest person! Someone I can talk to about anything and every thing, have the most fun with, and look up to endlessly. So grateful for your beautiful, curious, childlike spirit. Youre sunshine. Forever and ever in love with you. Through the note, Shalini expressed her admiration for Shabana not only as an accomplished actress but also as someone she shares a personal connection with. Her words highlighted the affection and warmth between the two actresses. Shalini and Shabana have also worked together in Dabba Cartel, bringing together performers from different generations. Shabana, who has had a long career in Indian cinema, shares the screen with Shalini, who belongs to a younger generation of actors. Their association in the series has also given audiences an opportunity to see the two actresses together. However, Shalinis birthday message focused more on their personal equation than their professional association. Her note reflected the fondness and admiration she has for Shabana, whom she described as someone she can have conversations with, enjoy time with and continue to admire. From their collaboration in Dabba Cartel to Shalinis personal birthday tribute, the message offered a glimpse into the warm equation shared by the two actresses. Also Read : Shalini Pandey reacts to fake AI-generated video: It is deeply disturbing to see technology being misused in this way [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [35] => Array ( [image_path] => entertainment/ [image_id] => 7173992 [name] => 359340902Sana-Thampi-on-Lust-Stories-3-debut-I-didnt-know-it-was-news.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/sana-thampi-on-lust-stories-3-debut-i-didnt-know-it-was-kiran-raos-film-till-auditions/ [pub_date] => 2026-09-18 15:41:15 [feed_source_id] => 339 [feed_id] => 86867157 [category_id] => 8 [feed_title] => Sana Thampi on Lust Stories 3 debut: I didnt know it was Kiran Raos film till auditions [feed_description] => Model-turned-actress Sana Thampi has officially made her Bollywood debut with Lust Stories 3, which premiered on Netflix on September 18, headlining one of the four stories in the Netflix anthology. Her segment, directed by acclaimed filmmaker Kiran Rao, marks a significant launchpad as she steps from modelling into mainstream Hindi cinema. With the film now streaming, Thampi has opened up about how she came on board and what it was like to collaborate with Rao for the first time. She revealed that the process began without her knowing the projects high-profile credentials. Kiran is one of my favourite filmmakers, and we have seen the best come out of her. At the time of auditioning, I wasn't aware it was for her directorial or for Lust Stories 3. I was just told that it was for the role of a lead in a short film, Sana said. She added, I did an audition where my third meeting was with Gurfateh Pirzada. I thought it was for an audition again, but it turned out to be a final step. It was the makers finalising both of us for the story after Netflix's approval. Thampi also praised Raos working style, highlighting the directors meticulous approach and the supportive environment on set. I love Kiran Rao's attention to detail, and we've already seen it in the projects she has done before. I am really glad to have worked with the entire team, they made it so incredibly fun, exciting and a stress-free experience for me, she said. Lust Stories 3 places Thampi alongside a formidable ensemble, including Radhika Apte, Vijay Varma, Konkona Sen Sharma and Abhishek Banerjee across its four stories. Sharing screen space with such established names adds weight to her debut and positions her as a promising new face in Bollywood. As audiences explore the anthologys varied narratives on love, desire and modern relationships, Thampis segment promises fresh energy and the backing of a director known for nuanced storytelling. For now, the actor is eagerly waiting for more response to her first film, while she described her experience of doing Lust Stories 3 as both exciting and stress-freea strong start to what could be a defining career chapter. Also Read: Lust Stories 3 trailer out: Netflix anthology promises messy relationships, unexpected choices and shades of desire [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [36] => Array ( [image_path] => entertainment/ [image_id] => 7173976 [name] => 2042420157msid-134331674,imgsize-137828.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/hollywood/news/sway-dasafo-passes-away-at-44-london-rapper-and-uk-hip-hop-pioneer-remembered-by-ksi-mobo-awards-and-more/articleshow/134331655.cms [pub_date] => 2026-09-18 15:25:15 [feed_source_id] => 3 [feed_id] => 86867137 [category_id] => 8 [feed_title] => Sway DaSafo passes away at 44 [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [37] => Array ( [image_path] => topnews/ [image_id] => 7173933 [name] => 670783638Screenshot202026-09-1820140403.png [feed_url] => https://www.thehindu.com/entertainment/movies/resident-evil-movie-review-zach-cregger-austin-abrams/article71479929.ece [pub_date] => 2026-09-18 15:18:33 [feed_source_id] => 28 [feed_id] => 86867075 [category_id] => 1 [feed_title] => Resident Evil movie review: 97 minutes is all Zach Cregger can spare for this monstrously good time [feed_description] => Zach Cregger turns one doomed delivery into an infectiously funny Resident Evil speedrun. A certified Raccoon City banger [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [38] => Array ( [image_path] => entertainment/ [image_id] => 7173977 [name] => 689210440msid-134331415,imgsize-218952.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/taimur-told-saif-ali-khan-to-forgive-his-attacker-he-wanted-rs-1-crore-for-his-mothers-surgery-reveals-kareena-kapoor-khan-the-fact-is-that-he-did-suffer-so-how-do-i-get-justice-for-that/articleshow/134331296.cms [pub_date] => 2026-09-18 15:11:51 [feed_source_id] => 3 [feed_id] => 86867138 [category_id] => 8 [feed_title] => Taimur told Saif to forgive his attacker, he wanted Rs 1 crore for his mother's surgery [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [39] => Array ( [image_path] => topnews/ [image_id] => 7173898 [name] => 607215020dupahiya-season-2-to-premiere-on-prime-video-on-october-1.jpg [feed_url] => https://thenewsmill.com/2026/09/dupahiya-season-2-to-premiere-on-prime-video-on-october-1/ [pub_date] => 2026-09-18 15:03:02 [feed_source_id] => 749 [feed_id] => 86867003 [category_id] => 1 [feed_title] => Dupahiya season 2 to premiere on Prime Video on October 1 [feed_description] => The News Mill [provider_name] => The News Mill [provider_slugname] => thenewsmill [source_icon] => source_logo/The-News-Mill.png ) [40] => Array ( [image_path] => topnews/ [image_id] => 7173813 [name] => 1992368718darenijaat.jpg [feed_url] => https://www.siasat.com/pak-drama-dar-e-nijaat-quits-youtube-where-to-watch-it-tonight-3544095/ [pub_date] => 2026-09-18 14:51:38 [feed_source_id] => 418 [feed_id] => 86866871 [category_id] => 1 [feed_title] => Pak drama Dar-e-nijaat exits YouTube: Where to watch it tonight? [feed_description] => Hyderabad: Dar-e-Nijaat has quickly emerged as one of the most-watched and trending Pakistani dramas among viewers in India. Starring Dur-e-Fishan Saleem, Nameer Khan and Sheheryar Munawar in lead roles, the 2026 drama has managed to keep audiences hooked with its emotional storyline and complicated relationships. So far, 13 episodes of Dar-e-Nijaat have aired, with all Get the latest updates in Hyderabad City News , Technology , Entertainment , Sports , Politics and Top Stories on WhatsApp & Telegram by subscribing to our channels. You can also download our app for Android and iOS . [provider_name] => The Siasat Daily [provider_slugname] => siasat [source_icon] => source_logo/siasat.png ) [41] => Array ( [image_path] => entertainment/ [image_id] => 7173978 [name] => 120340374msid-134331019,imgsize-175090.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/raaka-is-will-smith-joining-allu-arjun-deepika-padukone-and-atlees-sci-fi-epic-makers-tease-global-triumph-in-latest-update/articleshow/134330951.cms [pub_date] => 2026-09-18 14:49:13 [feed_source_id] => 3 [feed_id] => 86867139 [category_id] => 8 [feed_title] => Allu Arjun, Atlees 'Raaka' makers tease global triumph in latest update [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [42] => Array ( [image_path] => topnews/ [image_id] => 7173826 [name] => 616137099eNg1_NX54JeEKvPEZ2eBM4P-whNcjfSDDpAHxVvS1SqN0stAV2I75ySXGIkNlilMW-nW8KlQw9Bgyj5YKCAySdTszchQm_17UAbMN6sOC3Wp4k8_0zAoHpNjeq_jMQbXpLMvw0-kFH-dVBHEH8QXegVYr8nvUkS_MtVeLorrRbtI2z9VpjD1TlW382BKM4a6.jpg [feed_url] => https://www.thehindu.com/entertainment/movies/reacher-season-4-review-alan-ritchson-continues-to-punch-heads-and-influence-people-in-an-uneven-outing/article71476536.ece [pub_date] => 2026-09-18 14:48:01 [feed_source_id] => 28 [feed_id] => 86866891 [category_id] => 1 [feed_title] => Reacher Season 4 review: Alan Ritchson continues to punch heads and influence people in an uneven outing [feed_description] => While the final face-off between Reacher and his antagonists is satisfyingly brutal and bloody, the lead up to it is not as engaging, bogged down by a lot of running, knocking heads and clunky dialogue [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [43] => Array ( [image_path] => entertainment/ [image_id] => 7173979 [name] => 667281938msid-134330862,imgsize-274683.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/tukaram-mundhe-says-shah-rukh-khan-ajay-devgn-tiger-shroff-are-violators-of-the-law-as-he-speaks-on-their-elaichi-ad-row-there-is-a-responsibility-cast-upon-the-person-who-is-advertising-it/articleshow/134330781.cms [pub_date] => 2026-09-18 14:37:39 [feed_source_id] => 3 [feed_id] => 86867140 [category_id] => 8 [feed_title] => Tukaram Mundhe says SRK, Ajay Devgn, Tiger Shroff are 'violators of the law' [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [44] => Array ( [image_path] => entertainment/ [image_id] => 7173991 [name] => 1086486218file-image-2026-09-18t142235-1789721532.webp [feed_url] => https://www.indiatvnews.com/entertainment/news/varun-dhawan-to-make-hosting-debut-with-karan-johar-at-iifa-2027-in-abu-dhabi-salman-khan-kareena-kapoor-janhvi-kapoor-to-perform-2026-09-18-1054612 [pub_date] => 2026-09-18 14:30:05 [feed_source_id] => 125 [feed_id] => 86867152 [category_id] => 8 [feed_title] => Varun Dhawan to make hosting debut with Karan Johar at IIFA 2027 in Abu Dhabi; Salman, Kareena to perform [feed_description] => Bollywood actor Varun Dhawan is set to take on a new role at the International Indian Film Academy Awards as he turns host for IIFA 2027. The actor will co-host the main IIFA Awards with filmmaker and television personality Karan Johar, marking Varuns first stint as the main host of the awards ceremony. [provider_name] => India TV [provider_slugname] => indiatvnews [source_icon] => source_logo/IndiaTV.jpg ) [45] => Array ( [image_path] => entertainment/ [image_id] => 7173985 [name] => 700087455Amol-Parashar-y-1789702367523_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/amol-parashar-shares-the-valuable-birthday-gift-one-can-give-as-he-turns-40-23650598 [pub_date] => 2026-09-18 14:21:48 [feed_source_id] => 182 [feed_id] => 86867146 [category_id] => 8 [feed_title] => Amol Parashar shares the valuable birthday gift one can give as he turns 40 [feed_description] => Actor Amol Parashar, who is celebrating his 40th birthday on Thursday, has spoken about what he values the most as a gesture from someone. He added that he has never been big on birthdays, and this year is going to be no different [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [46] => Array ( [image_path] => entertainment/ [image_id] => 7173986 [name] => 1072546626namrat-ganesh-1789703243864_d.png [feed_url] => https://www.mid-day.com/entertainment/regional-indian-cinema-news/article/ganesh-chaturthi-2026-namrata-shirodkar-shares-glimpse-of-in-house-visarjan-23650602 [pub_date] => 2026-09-18 14:16:58 [feed_source_id] => 182 [feed_id] => 86867147 [category_id] => 8 [feed_title] => Ganesh Chaturthi 2026: Namrata Shirodkar shares glimpse of in-house visarjan [feed_description] => Actress Namrata Shirodkar gave a glimpse of her Ganesh Chaturthi celebrations.She further shared a video featuring her children, daughter Sitara and son Gautam, as the family bid farewell to Ganpati Bappa [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [47] => Array ( [image_path] => entertainment/ [image_id] => 7173987 [name] => 543389310gulzar-irrfan-1789698347514_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/meghna-gulzar-hails-irrfan-khan-performance-in-talvar-says-he-convinced-audience-23650587 [pub_date] => 2026-09-18 14:14:32 [feed_source_id] => 182 [feed_id] => 86867148 [category_id] => 8 [feed_title] => Meghna Gulzar hails Irrfan Khan's performance in Talvar [feed_description] => Filmmaker Meghna Gulzar, who is gearing up for the release of her upcoming film Daayra starring Prithviraj Sukumaran and Kareena Kapoor Khan, has credited the late actor Irrfan Khan's powerful performance in Talvar for convincing the audience about Aarushi Talwar's parents [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [48] => Array ( [image_path] => entertainment/ [image_id] => 7173989 [name] => 1382279508priyadarshan-182633675-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/celebrities/story/still-dont-know-how-to-make-a-successful-one-priyadarshan-after-making-98-films-2997555-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 13:58:28 [feed_source_id] => 7 [feed_id] => 86867150 [category_id] => 8 [feed_title] => Still don't know how to make a successful one: Priyadarshan after making 98 films [feed_description] => Still don't know how to make a successful one: Priyadarshan after making 98 films [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [49] => Array ( [image_path] => entertainment/ [image_id] => 7173980 [name] => 1720059893msid-134330148,imgsize-179711.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/no-gluten-no-refined-sugars-no-dairy-when-katrina-kaif-got-candid-about-her-diet-rules-and-fitness-mantra/articleshow/134330102.cms [pub_date] => 2026-09-18 13:55:44 [feed_source_id] => 3 [feed_id] => 86867141 [category_id] => 8 [feed_title] => When Katrina Kaif got candid about her diet rules and fitness mantra [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [50] => Array ( [image_path] => entertainment/ [image_id] => 7173981 [name] => 1122910686msid-134329501,imgsize-127096.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/its-not-just-about-his-stardom-or-box-office-success-nani-praises-tamil-nadu-cm-vijays-political-journey-during-the-paradise-promotions-questions-pan-india-tag-for-south-films/articleshow/134329491.cms [pub_date] => 2026-09-18 13:52:07 [feed_source_id] => 3 [feed_id] => 86867142 [category_id] => 8 [feed_title] => Nani praises Tamil Nadu CM Vijay, questions pan-India tag for South films [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [51] => Array ( [image_path] => topnews/ [image_id] => 7173671 [name] => 9487740file-image-2026-09-18t134254-1789719148.webp [feed_url] => https://www.indiatvnews.com/entertainment/bollywood/alia-bhatt-ranbir-kapoor-pledge-to-refurbish-20-schools-ranveer-singh-announces-education-of-1-000-girls-on-pm-modi-s-birthday-2026-09-18-1054609 [pub_date] => 2026-09-18 13:47:33 [feed_source_id] => 125 [feed_id] => 86866628 [category_id] => 1 [feed_title] => Alia Bhatt, Ranbir Kapoor pledge to refurbish 20 schools; Ranveer Singh supports education of 1,000 girls [feed_description] => Several Bollywood celebrities marked Prime Minister Narendra Modis 76th birthday on September 17 with social media messages, while some also announced contributions towards education and community initiatives. Alia Bhatt and Ranbir Kapoor pledged to support the refurbishment of 20 schools, while Ranveer Singh announced that he would support the education of 1,000 girls as part of the Seva Sankalp Abhiyan. [provider_name] => India TV [provider_slugname] => indiatvnews [source_icon] => source_logo/IndiaTV.jpg ) [52] => Array ( [image_path] => topnews/ [image_id] => 7173655 [name] => 183838940618fr_Meenakshi20temple20Tower20and20birds20for20cover.jpg [feed_url] => https://www.thehindu.com/society/history-and-culture/meenakshi-temple-the-making-of-madurais-greatest-landmarks/article71475643.ece [pub_date] => 2026-09-18 13:46:20 [feed_source_id] => 28 [feed_id] => 86866597 [category_id] => 1 [feed_title] => Meenakshi Temple: The making of Madurais greatest landmarks [feed_description] => Consecrated after a gap of 17 years, the Meenakshi-Sundareswarar Temple, built and expanded by successive dynasties, is one of Indias architectural marvels. [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [53] => Array ( [image_path] => entertainment/ [image_id] => 7173988 [name] => 562548927kamhrahsnxj-1789719048107_d.png [feed_url] => https://www.mid-day.com/entertainment/regional-indian-cinema-news/article/ms-subbulakshmi-biopic-kamal-haasan-compares-rashmikas-role-to-michael-jackson-23650638 [pub_date] => 2026-09-18 13:46:11 [feed_source_id] => 182 [feed_id] => 86867149 [category_id] => 8 [feed_title] => MS Subbulakshmi biopic: Kamal Haasan compares Rashmikas role to Michael Jackson [feed_description] => Rashmika Mandannas casting as M.S. Subbulakshmi has faced criticism from some social media users. At the biopics launch, Kamal Haasan backed her and compared the pressure of the role to that of portraying Michael Jackson in a biopic [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [54] => Array ( [image_path] => entertainment/ [image_id] => 7173630 [name] => 299023131Jitin-Gulati-620.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/exclusive-is-maa-2-happening-mahakali-and-fauzi-actor-jitin-gulati-says-theres-always-a-possibility-these-stories-lend-themselves-to-different-versions/ [pub_date] => 2026-09-18 13:41:01 [feed_source_id] => 339 [feed_id] => 86866549 [category_id] => 8 [feed_title] => EXCLUSIVE: Is Maa 2 happening? Mahakali and Fauzi actor Jitin Gulati says, Theres always a possibility...these stories lend themselves to different versions [feed_description] => After working in Broken But Beautiful, Bambai Meri Jaan, Kajol-starrer Maa (2025), etc., Jitin Gulati will next be seen in two Pan-India projects Mahakali, co-starring Akshaye Khanna, and Prabhas-starrer Fauzi. In an exclusive interview with Bollywood Hungama, the talented actor explained how these films should benefit him, and also opened up on the possible sequel to Maa. Both Mahakali and Fauzi are Pan-India films and will be seen by a large section of moviegoing audiences across the country. When asked whether he hopes to get more author-backed roles from now on, the actor replied, Thats always the hope. I am just grateful because whatever I am doing in Telugu is possible because I have learned a lot while working on the Hindi films I did before. I have worked with varied directors, from Neeraj Pandey to Habib Faisal to Gurmmeet Singh to Bejoy Nambiar. Today, I am able to work in bigger setups simply because I have learned so much from these directors. So, the hope is that I move forward from here and I move upwards from here. I also hope I get better author-backed roles in Hindi as well. But I am not limiting myself to Bollywood. As we speak, I am chasing work in Tamil, Malayalam and other regional cinema as well (smiles). Wherever there is good work and a good director, I want to be a part of that. Last year, Jitin Gulati was seen in Maa in the role of a cop. The horror film did decent business at the box office and also garnered healthy viewership on Netflix. Jitin remarked, Every film that does well, is watched by a large number of people and, especially, features a known superstar benefits you. Maa had Kajol, and now I have worked with Akshaye Khanna and Prabhas in Mahakali and Fauzi, respectively; that always helps. A large number of people watch these films and, because of them, actors like me also get noticed. So, Maa did benefit me a lot. It was a theatrical success and did very well on Netflix as well. Is Kajol intimidating, as she is sometimes perceived to be? Jitin Gulati instantly replied, No. Shes very true to herself and people view it as being intimidating. But shes literally very easy to work with and shes very genuine as a person. For her, black is black (laughs). Because she doesnt mince her words, people find that intimidating. Otherwise, shes a joy to work with. There have been reports that a sequel to Maa is being planned. When asked about it, the actor replied, For that, you should check with either Devgn Films or Vishal Furia sir. They would be able to confirm. He continued, Theres always a possibility because stories like these lend themselves to different versions. However, the makers would know better. Finally, we asked him about his future projects. Jitin Gulati answered, Currently, I am in the middle of shooting Fauzi. Besides, I have shot a bit for a Hindi film. Ill finish shooting for it most probably this year or early next year. Itll release in 2027 as well. Itll be my first lead role in Hindi. Its a very good part and I'm quite kicked about it (smiles). Also Read: EXCLUSIVE: Jitin Gulati recalls being star-struck on meeting Prabhas for the first time: It felt like Amarendra Baahubali was walking in!; opens up on Fauzi: What they are creating has NEVER been seen before [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [55] => Array ( [image_path] => entertainment/ [image_id] => 7173629 [name] => 1590244395620x450-18092026-16.jpg.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/sandeepa-dhar-celebrates-ganesh-chaturthi-with-chumbak-co-stars-visits-lalbaugcha-raja/ [pub_date] => 2026-09-18 13:41:00 [feed_source_id] => 339 [feed_id] => 86866548 [category_id] => 8 [feed_title] => Sandeepa Dhar celebrates Ganesh Chaturthi with Chumbak co-stars, visits Lalbaugcha Raja [feed_description] => Ganesh Chaturthi brought together moments of devotion and celebration for actress Sandeepa Dhar, who marked the festival with visits to Lord Ganesha and time spent with her industry friends. The actress shared glimpses from her celebrations, including a visit to Arjun Bijlanis residence and a reunion with her Chumbak co-stars. Sandeepa first visited the home of her Chumbak co-star Arjun Bijlani to seek blessings from Lord Ganesha. Dressed in a yellow ethnic outfit, she shared a picture of herself praying in front of a floral-decorated Ganpati idol. Sharing the moment on social media, she captioned it, Gannu ji. The festival also gave the cast of Chumbak an opportunity to come together. Sandeepa shared a group selfie featuring Arjun Bijlani, veteran actress Neena Gupta, Helly Shah and Delnaaz Irani. The picture showed the actors posing together during the celebrations. Expressing her affection for the group, Sandeepa captioned the post, My Chumbak's. View this post on Instagram A post shared by Sandeepa dhar (@iamsandeepadhar) As part of her Ganesh Chaturthi celebrations, Sandeepa also visited Mumbai's Lalbaugcha Raja to seek blessings. Sharing a picture of the revered Ganpati idol, she expressed her gratitude and spiritual connection with the visit. She captioned the post, Lal Baug ka Raja ! Blessed . Through her social media posts, Sandeepa offered glimpses of how she celebrated the festival, combining prayers and festive moments with friends and co-stars. The reunion with the Chumbak cast also gave her followers a glimpse of the camaraderie shared by the team. Also Read : Chumbak gave me a sisterhood Ill cherish forever, says Sandeepa Dhar on her Chumbak girl gang [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [56] => Array ( [image_path] => entertainment/ [image_id] => 7173628 [name] => 457523510Celina-Jaitly-heartbreaking-photo.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/celina-jaitly-shares-heartbreaking-throwback-picture-with-parents-brother-and-sons-i-have-lost-my-most-valuable-treasures/ [pub_date] => 2026-09-18 13:41:00 [feed_source_id] => 339 [feed_id] => 86866547 [category_id] => 8 [feed_title] => Celina Jaitly shares heartbreaking throwback picture with parents, brother and sons: I have lost my most valuable treasures [feed_description] => Celina Jaitly has shared an emotional throwback photograph featuring several of the people she has described as her most valuable treasures. The actor shared the picture on social media on September 17, reflecting on loss, family and the pain of looking back at moments that can no longer be recreated. The photograph features Celina with her late parents, her brother Major (Retd.) Vikrant Kumar Jaitly, and her twin sons Winston and Viraaj Haag. Her younger son Arthur, who was not yet born when the photograph was taken, is absent from the frame. Sharing the picture, Celina wrote, #alone : I am unsure which pain was worse.. the shock of what happened or the ache for what never will. She went on to reflect on the series of personal losses her family has experienced and how the photograph has taken on a different meaning with time. I still cannot believe the tragedies that have struck our family. In the blink of an eye, I find myself staring at a photograph surrounded by my most valuable treasures ( only Arthur is missing he wasnt born yet) Celina Jaitly reflects on family, loss and memories The actor described the photograph as a reminder of a life that once felt ordinary, but has since been marked by significant changes and loss. I find myself in a script I didnt sign up for.. A story only possible in films.. Celina also spoke about how everyday family relationships can sometimes be taken for granted, only for their importance to become clearer after loss. We take our relationships for granted. Our parents, our siblings, our children We go about our days complaining so passionately about the smallest things, never imagining that the ordinary moments we barely notice will one day become everything we long for. She added, Then life hits, and the world we knew is gone. Yet there is the photograph. Those faces. That love. And the unbearable longing to step inside it, just once more. View this post on Instagram A post shared by Celina Jaitly (@celinajaitlyofficial) A family marked by multiple losses Celina has experienced the loss of both her parents within a span of less than a year. Her father, Colonel Vikram Kumar Jaitly, a retired Indian Army officer, died on July 2, 2017, following a prolonged illness. Her mother, Dr. Meeta Jaitly, a child psychologist and literature professor, died on June 8, 2018, after battling cancer. The actor also lost her son Shamsher, one of her twin boys born in 2017. Shamsher died shortly after birth due to hypoplastic left heart syndrome, a severe congenital heart condition. His twin brother Arthur survived. Celina has previously spoken publicly about the impact of losing Shamsher and has continued to remember him through social media posts. Her recent family photograph comes at a particularly difficult period in her personal life. She is currently involved in divorce and custody proceedings with her estranged husband Peter Haag. Celina has publicly spoken about being separated from her three surviving sons, Winston, Viraaj and Arthur, who are in Austria. She has also expressed distress over missing important moments in their lives, including the beginning of the new school year. Celina Jaitlys ongoing family struggles Alongside the custody dispute, Celina has also been seeking information and communication concerning her brother, Major (Retd.) Vikrant Kumar Jaitly, who has been detained in the UAE since September 2024. The Delhi High Court had considered her petition seeking assistance and communication with him. In March 2026, the court closed that petition after a statement attributed to Vikrant during a consular visit was placed on record saying he did not wish to communicate with his sister. Celina has continued to speak publicly about the emotional toll of the circumstances surrounding her family. In a recent post about her brother, she referred to her parents no longer being alive and described him as someone whose absence has deeply affected her. In her latest post, however, Celina's focus remained on the photograph and what it represents to her. Reflecting on questions that have remained unanswered, she wrote, I dont know whether this is karma from a past life or some incomprehensible journey of the soul. No answer brings me comfort. No explanation makes the absence easier to bear. Concluding her note, she said, I have lost my most valuable treasures and this, my heart cannot accept. Also Read: Celina Jaitly pens emotional note for sons amid divorce battle with husband: You never have to choose [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [57] => Array ( [image_path] => entertainment/ [image_id] => 7173990 [name] => 1402344690dev-sharma-185852603-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/celebrities/story/dev-sharma-now-ram-in-ramayan-katha-was-rejected-as-lakshman-in-ranbir-kapoor-ramayana-adipurush-2997531-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 13:40:59 [feed_source_id] => 7 [feed_id] => 86867151 [category_id] => 8 [feed_title] => Dev Sharma, now Ram in Ramayan Katha, was rejected as Lakshman in Ranbir's Ramayana [feed_description] => Dev Sharma, now Ram in Ramayan Katha, was rejected as Lakshman in Ranbir's Ramayana [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [58] => Array ( [image_path] => entertainment/ [image_id] => 7173619 [name] => 1070400390ramhinvefnv-1789715475476_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/ranbir-kapoor-ramayana-english-version-to-be-30-minutes-shorter-than-hindi-cut-heres-why-23650628 [pub_date] => 2026-09-18 13:30:55 [feed_source_id] => 182 [feed_id] => 86866538 [category_id] => 8 [feed_title] => Ramayana's English version to be 30 minutes shorter than Hindi cut, here's why [feed_description] => Ranbir Kapoor-starrer Ramayana will reportedly have an English version around 30 minutes shorter than the Hindi cut. The global edit will omit songs and trim some scenes to make the film more suitable for international audiences [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [59] => Array ( [image_path] => entertainment/ [image_id] => 7173620 [name] => 1809848173fgsherywrgfd-1789717896045_d.png [feed_url] => https://www.mid-day.com/entertainment/hollywood-news/article/kim-kardashian-secures-protection-for-children-against-stalker-who-sent-birth-control-pills-23650635 [pub_date] => 2026-09-18 13:26:43 [feed_source_id] => 182 [feed_id] => 86866539 [category_id] => 8 [feed_title] => Why Kim Kardashian added her kids to restraining order against stalker [feed_description] => Kim Kardashians four children, North, Saint, Chicago and Psalm West, have been added to the restraining order against Nicholas Costanza, whom she has accused of stalking her for years. The order follows allegations that Costanza previously sent a diamond ring and birth control pills to her [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [60] => Array ( [image_path] => topnews/ [image_id] => 7173546 [name] => 1814045814salman-mobbed.jpg [feed_url] => https://www.siasat.com/watch-salman-khan-stops-to-make-little-boys-happy-amid-fan-mob-3544159/ [pub_date] => 2026-09-18 13:20:24 [feed_source_id] => 418 [feed_id] => 86866440 [category_id] => 1 [feed_title] => Watch: Salman Khan stops to make little boys happy amid fan mob [feed_description] => Mumbai: Bollywood superstar Salman Khan was mobbed by fans and photographers as he stepped out after attending Ganpati darshan at Maharashtra minister Ashish Shelars residence in Mumbai on Thursday night. Amid the frenzy, the actor made sure to acknowledge young fans who were waiting eagerly to meet him. Videos captured from the occasion show Salman Get the latest updates in Hyderabad City News , Technology , Entertainment , Sports , Politics and Top Stories on WhatsApp & Telegram by subscribing to our channels. You can also download our app for Android and iOS . [provider_name] => The Siasat Daily [provider_slugname] => siasat [source_icon] => source_logo/siasat.png ) [61] => Array ( [image_path] => entertainment/ [image_id] => 7173621 [name] => 696881662dnurw-1789717410149_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/mirzapur-the-movie-mohit-malik-pankaj-tripathi-rasika-dugal-ravi-kishan-23650632 [pub_date] => 2026-09-18 13:14:13 [feed_source_id] => 182 [feed_id] => 86866540 [category_id] => 8 [feed_title] => Mirzapur The Movie: Mohit Malik reveals deleted scene of Birju-Beena's love saga [feed_description] => Mohit Malik opens up about his memorable Birju Lohar role in Mirzapur: The Movie, revealing the intensity behind his fight with Pankaj Tripathi, the deleted letters scene, Beena tattoos significance and his emotional connection to the films song [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [62] => Array ( [image_path] => entertainment/ [image_id] => 7173609 [name] => 467963028msid-134329346,imgsize-284369.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/ramayana-part-1-ranbir-kapoor-sai-pallavi-and-yash-starrer-to-skip-songs-trim-scenes-and-have-a-30-minute-shorter-english-cut-for-international-audiences-than-hindi-version/articleshow/134329332.cms [pub_date] => 2026-09-18 13:09:19 [feed_source_id] => 3 [feed_id] => 86866516 [category_id] => 8 [feed_title] => Ramayana: Part 1: English cut drops songs, runs 30 minutes shorter [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [63] => Array ( [image_path] => entertainment/ [image_id] => 7173610 [name] => 601636978msid-134329301,imgsize-292191.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/hollywood/news/steve-mcqueens-rare-blue-sera-1967-ferrari-275-gtb/4s-nart-spider-from-the-thomas-crown-affair-to-be-auctioned-in-new-york-for-estimated-usd-15-20-million/articleshow/134329213.cms [pub_date] => 2026-09-18 13:06:38 [feed_source_id] => 3 [feed_id] => 86866517 [category_id] => 8 [feed_title] => Steve McQueens rare Ferrari is being auctioned soon [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [64] => Array ( [image_path] => entertainment/ [image_id] => 7173611 [name] => 176079048msid-134329123,imgsize-261636.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/music/news/billy-bragg-urges-ed-sheeran-to-cancel-remaining-tour-dates-over-macklemore-row-warns-singer-could-become-a-pariah-and-controversy-could-tarnish-his-career/articleshow/134329089.cms [pub_date] => 2026-09-18 13:02:56 [feed_source_id] => 3 [feed_id] => 86866518 [category_id] => 8 [feed_title] => Billy Bragg urges Ed Sheeran to cancel tour [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [65] => Array ( [image_path] => entertainment/ [image_id] => 7173612 [name] => 223349602msid-134329188,imgsize-167943.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/lalit-modis-life-story-to-be-made-into-a-film-exploring-the-ipl-founders-rise-success-and-controversies-report/articleshow/134329167.cms [pub_date] => 2026-09-18 13:01:09 [feed_source_id] => 3 [feed_id] => 86866519 [category_id] => 8 [feed_title] => Lalit Modi biopic: Sajid Nadiadwala backs feature-film [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [66] => Array ( [image_path] => entertainment/ [image_id] => 7173613 [name] => 46610372msid-134329122,imgsize-272786.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/telugu/movies/news/the-paradise-nani-srikanth-odela-and-anirudh-ravichander-unveil-welcome-to-the-era-of-three-crows-poster-ahead-of-september-24-theatrical-release/articleshow/134329095.cms [pub_date] => 2026-09-18 12:57:38 [feed_source_id] => 3 [feed_id] => 86866523 [category_id] => 8 [feed_title] => The Paradise pic with Nani, Srikanth Odela, and Anirudh as three crows goes viral [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [67] => Array ( [image_path] => entertainment/ [image_id] => 7173622 [name] => 1093655092azmi-balan-1789703930191_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/shabana-azmi-thanks-vidya-balan-for-borderless-talent-birthday-tribute-23650604 [pub_date] => 2026-09-18 12:36:50 [feed_source_id] => 182 [feed_id] => 86866541 [category_id] => 8 [feed_title] => Shabana Azmi thanks Vidya Balan for 'borderless talent' birthday tribute [feed_description] => Shabana Azmi thanked Vidya Balan and her producer-husband Siddharth Roy Kapur for a special birthday gesture ahead of her 75th birthday. The duo surprised the veteran actress with a creative cake featuring an artistic representation of her and a message celebrating her borderless talent [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [68] => Array ( [image_path] => entertainment/ [image_id] => 7173614 [name] => 1923382166msid-134328709,imgsize-270706.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/kunal-kemmu-explains-why-he-cast-preity-zinta-against-type-in-vibe-i-had-never-seen-her-do-action/articleshow/134328676.cms [pub_date] => 2026-09-18 12:36:17 [feed_source_id] => 3 [feed_id] => 86866526 [category_id] => 8 [feed_title] => Kemmu casts Zinta against type: Director wanted a badass avatar [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [69] => Array ( [image_path] => topnews/ [image_id] => 7173476 [name] => 589548350file-image-2026-09-18t112424-1789710840.webp [feed_url] => https://www.indiatvnews.com/entertainment/korean/the-scandal-is-out-on-netflix-dyk-son-ye-jin-ji-chang-wook-s-k-drama-is-based-on-18th-century-novel-2026-09-18-1054597 [pub_date] => 2026-09-18 12:35:49 [feed_source_id] => 125 [feed_id] => 86866284 [category_id] => 1 [feed_title] => The Scandal is out on Netflix; DYK Son Ye-jin and Ji Chang-wook's K-drama is based on 18th-century novel? [feed_description] => South Korean actors Son Ye-jin and Ji Chang-wook's much-awaited K-drama The Scandal is now streaming on Netflix. The eight-episode period romance, directed by Jung Ji-woo, takes viewers to the Joseon era and centres on a dangerous game of seduction, desire and manipulation. [provider_name] => India TV [provider_slugname] => indiatvnews [source_icon] => source_logo/IndiaTV.jpg ) [70] => Array ( [image_path] => entertainment/ [image_id] => 7173615 [name] => 628953806msid-134328681,imgsize-530611.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/malayalam/movies/news/maharaja-hostel-ott-release-when-and-where-to-watch-akhil-nrds-college-horror-comedy-online-after-its-theatrical-run/articleshow/134328588.cms [pub_date] => 2026-09-18 12:34:40 [feed_source_id] => 3 [feed_id] => 86866528 [category_id] => 8 [feed_title] => Maharaja Hostel OTT release [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [71] => Array ( [image_path] => entertainment/ [image_id] => 7173623 [name] => 590423992catherin-1789699383820_d.png [feed_url] => https://www.mid-day.com/entertainment/hollywood-news/article/catherine-zeta-jones-calls-father-her-greatest-gift-on-his-80th-birthday-23650589 [pub_date] => 2026-09-18 12:29:07 [feed_source_id] => 182 [feed_id] => 86866542 [category_id] => 8 [feed_title] => Catherine Zeta-Jones calls father her 'greatest gift' on his 80th birthday [feed_description] => Catherine Zeta-Jones celebrated her fathers 80th birthday with a heartfelt Instagram post, sharing a happy picture of the two together. The Oscar-winning actor expressed her love for her dad and called herself the luckiest girl in the world to have a father like him [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [72] => Array ( [image_path] => topnews/ [image_id] => 7173418 [name] => 8829895585I4A4465.JPG [feed_url] => https://www.thehindu.com/entertainment/music/india-music-retreat-brings-audiences-closer-to-music-through-performances-and-shared-listening/article71475662.ece [pub_date] => 2026-09-18 12:27:28 [feed_source_id] => 28 [feed_id] => 86866182 [category_id] => 1 [feed_title] => India Music Retreat brings audiences closer to music through performances and shared listening [feed_description] => At a three-day music retreat in Jaipur, performances, conversations and shared listening turn music into an experience that extends beyond the concert hall [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [73] => Array ( [image_path] => entertainment/ [image_id] => 7173616 [name] => 1797615051msid-134328415,imgsize-257924.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/arulnithi-and-ajay-gnanamuthus-demonte-colony-3-faces-release-roadblock-as-chennai-high-court-grants-interim-stay-over-production-and-distribution-rights-dispute/articleshow/134328404.cms [pub_date] => 2026-09-18 12:24:19 [feed_source_id] => 3 [feed_id] => 86866532 [category_id] => 8 [feed_title] => Arulnithi and Ajay Gnanamuthu's Demonte Colony 3 faces release roadblock [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [74] => Array ( [image_path] => topnews/ [image_id] => 7173469 [name] => 1947744461Lust20stories20320netflix20review.jpg [feed_url] => https://www.thehindu.com/entertainment/movies/lust-stories-3-movie-review-netflix-konkona-sen-sharma-radhika-apte-ali-fazal-siddharth-aditi-rao-hydari/article71479583.ece [pub_date] => 2026-09-18 12:23:44 [feed_source_id] => 28 [feed_id] => 86866270 [category_id] => 1 [feed_title] => Lust Stories 3 movie review: Life beyond the bedroom door [feed_description] => A mirror to modern relationships, the franchises third instalment sheds its past shock value for the disturbing terrain of emotional isolation [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [75] => Array ( [image_path] => entertainment/ [image_id] => 7173624 [name] => 1195851110cyrus-1789698947346_d.png [feed_url] => https://www.mid-day.com/entertainment/hollywood-news/article/miley-cyrus-opens-up-about-deeply-personal-process-behind-new-album-23650588 [pub_date] => 2026-09-18 12:23:13 [feed_source_id] => 182 [feed_id] => 86866543 [category_id] => 8 [feed_title] => Miley Cyrus opens up about deeply personal process behind new album [feed_description] => Miley Cyrus has opened up about the personal journey behind her upcoming 10th studio album, Bass Persuades. The singer said it feels special to watch the record evolve alongside her life in real time. Cyrus also thanked everyone who contributed to the album, which arrives on September 18 [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [76] => Array ( [image_path] => entertainment/ [image_id] => 7173625 [name] => 1340680525ranlipmoditnvn-1789713835062_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/alia-bhatt-ranbir-kapoor-pledge-to-refurbish-20-schools-in-mumbai-23650626 [pub_date] => 2026-09-18 12:19:32 [feed_source_id] => 182 [feed_id] => 86866544 [category_id] => 8 [feed_title] => Alia Bhatt, Ranbir Kapoor pledge to refurbish 20 schools in Mumbai [feed_description] => Alia Bhatt and Ranbir Kapoor have pledged to refurbish 20 schools in Mumbai as part of the Seva Sankalp Abhiyan. Alia announced the initiative on social media while wishing Prime Minister Narendra Modi on his 76th birthday [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [77] => Array ( [image_path] => entertainment/ [image_id] => 7173617 [name] => 1479440038msid-134328276,imgsize-322753.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/hindi/bollywood/news/ramayana-runtime-in-english-to-be-shorter-hindi-cut-of-ranbir-kapoor-and-yash-starrer-to-be-30-minutes-longer-with-song-sequences/articleshow/134327808.cms [pub_date] => 2026-09-18 12:17:40 [feed_source_id] => 3 [feed_id] => 86866535 [category_id] => 8 [feed_title] => 'Ramayana' English cut to be 30 minutes SHORTER than Hindi [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [78] => Array ( [image_path] => entertainment/ [image_id] => 7173626 [name] => 1937704642Matthew-Lillard-1789697936991_d.png [feed_url] => https://www.mid-day.com/entertainment/hollywood-news/article/matthew-lillard-regrets-not-speaking-up-after-melissa-barrera-scream-firing-23650586 [pub_date] => 2026-09-18 12:17:02 [feed_source_id] => 182 [feed_id] => 86866545 [category_id] => 8 [feed_title] => Matthew Lillard regrets not speaking up after Melissa Barrera's Scream firing [feed_description] => Matthew Lillard has opened up about returning as Stu Macher in Scream 7 after Melissa Barreras exit from the franchise. The actor admitted he feels embarrassed and shame about his decision, saying he should have spoken up at the time and questioning why he agreed to return [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [79] => Array ( [image_path] => entertainment/ [image_id] => 7173627 [name] => 245059250salmreschci-1789711813686_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/salman-khan-protects-young-fan-from-crowd-rush-at-ganpati-pandal-23650621 [pub_date] => 2026-09-18 11:47:28 [feed_source_id] => 182 [feed_id] => 86866546 [category_id] => 8 [feed_title] => Salman Khan protects young fan from crowd rush at Ganpati pandal [feed_description] => Salman Khans gesture towards a young fan at a Ganpati event has gone viral. Amid the crowd rush, the actor stopped to help the child, shook hands with him and gently moved him away from the crowd before heading to his car [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [80] => Array ( [image_path] => entertainment/ [image_id] => 7173618 [name] => 177839346msid-134327722,imgsize-67552.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/hollywood/news/dolly-parton-honoured-with-lifetime-achievement-award-posthumously-her-pre-recorded-message-leaves-everyone-emotional-just-know-that-i-will-always-love-you/articleshow/134327688.cms [pub_date] => 2026-09-18 11:45:09 [feed_source_id] => 3 [feed_id] => 86866537 [category_id] => 8 [feed_title] => Dolly Parton awarded Lifetime Achievement award [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [81] => Array ( [image_path] => entertainment/ [image_id] => 7173326 [name] => 1435498176Ranveer-Singh-at-Lalbaugh.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/ranveer-singh-seeks-blessings-at-lalbaugcha-raja-ahead-of-pralay-production-debut/ [pub_date] => 2026-09-18 11:41:20 [feed_source_id] => 339 [feed_id] => 86865966 [category_id] => 8 [feed_title] => Ranveer Singh seeks blessings at Lalbaugcha Raja ahead of Pralay production debut [feed_description] => Ranveer Singh was spotted at Mumbais iconic Lalbaugcha Raja, dressed in a traditional white kurta-pyjama, as he offered prayers and sought blessings for his upcoming project. The visit comes after what has been a remarkable year for Ranveer, with the Dhurandhar franchise enjoying a blockbuster run and further cementing his position as Indian cinemas leading superstar. From the massive response to his performance as Hamza to the franchises theatrical success at the box office, the year has marked another significant milestone in his career. View this post on Instagram A post shared by Bollywood Hungama (@realbollywoodhungama) Now, Ranveer is looking ahead to an exciting new phase with Pralay. The actor has begun shooting for the film, in which he will not only headline the project but also take on the role of producer. With Pralay, Ranveer is set to make his production debut under his banner Maa Kasam Films, adding another dimension to his evolving career in the entertainment industry. The Lalbaugcha Raja visit also comes at a particularly special time in Ranveers personal life. The actor and Deepika Padukone are also awaiting the arrival of their second child, making this phase one filled with both professional and personal milestones. From delivering a major franchise success with Dhurandhar to beginning work on Pralay and taking his first step as a producer, Ranveer Singh is entering a new chapter in his career. As he takes on these new responsibilities, his visit to Lalbaugcha Raja marks a heartfelt moment of seeking blessings before the journey ahead. Also Read:Ranveer Singh appreciates Karan D Kapadia of Hunkkaar the reason runs deeper than youd expect! [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [82] => Array ( [image_path] => entertainment/ [image_id] => 7173325 [name] => 1324324680Alia-Bhatt-on-Mahesh-Bhatt-quirk.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/alia-bhatt-reveals-one-mahesh-bhatt-quirk-that-annoys-her-now-i-do-the-exact-same-thing/ [pub_date] => 2026-09-18 11:41:19 [feed_source_id] => 339 [feed_id] => 86865965 [category_id] => 8 [feed_title] => Alia Bhatt reveals one Mahesh Bhatt quirk that annoys her: Now I do the exact same thing [feed_description] => Soni Razdan is currently promoting her recently released film Om Ka Hari, but a recent social media post gave fans a glimpse into her family dynamic with filmmaker Mahesh Bhatt and daughter Alia Bhatt. On September 17, Soni shared a video of Alia, seemingly recorded after a screening of the film, where the actor was asked about one quirk of her father that annoys her. Alia pointed out that having a conversation with her father can sometimes become confusing because he has a habit of mixing up the names of people around him. Its very difficult to have a smooth, easy, free-flowing conversation when he forgets who he's talking to and then calls me Shaheen and then sometimes Soni and then some other people that I've never heard of and then does the same thing with everyone else, Alia said. However, Alia admitted that what once annoyed her has now become a habit she has picked up herself. She added, But lo and behold, the apple doesn't fall very far from the tree, and now I do the exact same thing. So what's annoying is I've picked up on this quirk, and I've become this quirk. The conversation took another affectionate turn when Alia was asked when she had last told her father that she loved him. Instead of answering from memory, she decided to call him. Mahesh Bhatt happened to be at the same premises, at a preview theatre, and Alia called him on the spot. She then told him, I love you daddy. That was the last time. View this post on Instagram A post shared by Soni Razdan (@sonirazdan) Alia Bhatt on Mahesh Bhatts theatrical side Alia has previously spoken about her fathers distinctive personality and the memories she associates with growing up around him. In an earlier anecdote, she recalled how Mahesh Bhatt would use dramatic gestures to make ordinary moments memorable. My father is very theatrical and that sometimes makes for great memories. For example, when I was in 1st standard, I had a spelling test and I was worried I was, for some reason, going to forget the spelling of the. My father made it a point to build into my memory, so he did some overbearing gesture to teach me the spelling so I dont forget it. But I remember him being this, like, grizzly bear, highly theatrical and highly entertaining, she had said. Soni Razdan is part of Om Ka Hari, which releases theatrically on September 18. Directed by Harish Vyas and backed by First Ray Films, the film stars Anshuman Jha and Raghubir Yadav in the titular roles of Om and Hari. Also Read:Mahesh Bhatt reveals Alia Bhatts two-year-old daughter Raha has her own vanity van: It felt like a nursery, almost a temple [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [83] => Array ( [image_path] => entertainment/ [image_id] => 7173324 [name] => 1991748886Alia-Bhatt-on-Raha-first-word.jpeg [feed_url] => https://www.bollywoodhungama.com/news/features/alia-bhatt-recalls-rahas-first-word-and-her-fight-with-ranbir-kapoor-over-the-milestone-i-have-it-on-video-so-anybody-who-needs-proof/ [pub_date] => 2026-09-18 11:41:18 [feed_source_id] => 339 [feed_id] => 86865964 [category_id] => 8 [feed_title] => Alia Bhatt recalls Rahas first word and her fight with Ranbir Kapoor over the milestone: I have it on video. So anybody who needs proof [feed_description] => Alia Bhatt has often spoken about how motherhood changed her life, and in a 2024 interview with Allure, the actor opened up about some of her most memorable moments with daughter Raha. From describing her daughters birth as the most precious moment of her life to recalling the playful competition between her and Ranbir Kapoor over Rahas first word, Alia offered a glimpse into their family life. Alia Bhatt recalls Ranbir Kapoors fight over Rahas first word While talking about Rahas early milestones, Alia revealed that she and Ranbir had a rather adorable disagreement at home over whether their daughter would say mama or papa first. The backstory is there was a fight at home (about) Whether she is going to say mama first or whether she is going to say papa first. So, of course, mama was like (say), mama, mama, mama, and papa was like (say), papa, papa, papa. And when she said that, it was just me and her, I immediately pulled out my phone and said, say it say it again, what did you just say. Raha eventually said mama first, much to Alias delight. The actor also revealed that she made sure to capture the moment on camera, giving the family a permanent record of the milestone. She added, We take great joy and pride in that moment. So, I remember that moment very clearly and I have it on video. So anybody who needs proof, she said mama first. Alia calls Rahas birth the most precious moment of her life In the same interview, Alia also opened up about the day Raha was born, describing it as an experience she would never forget. Alia said, Ill never forget in my life, no matter what happens, is the day our daughter was born. I wont forget the moment where we first heard her sound. It was unreal. When I heard her voice, I felt like I had met God or something. It was so emotional, sort of surreal. The minute she was put on to me, I just felt an immediate dam of love sort of burst open in our life and it just felt safe and it felt like my purpose had been met. (Ill) never ever forget that day. Alia and Ranbir welcomed their daughter on November 6, 2022. Since then, the couple have largely kept Raha away from the spotlight, while occasionally sharing glimpses of their family life. Also Read:Alia Bhatt reveals one Mahesh Bhatt quirk that annoys her: Now I do the exact same thing [provider_name] => Bollywood Hungama [provider_slugname] => bollywoodhungama [source_icon] => source_logo/bollywoodhungama.png ) [84] => Array ( [image_path] => topnews/ [image_id] => 7173262 [name] => 1413304667mythri-ganga.jpg [feed_url] => https://www.siasat.com/brand-new-premium-single-screen-theatre-opens-in-hyderabad-today-3544019/ [pub_date] => 2026-09-18 11:10:36 [feed_source_id] => 418 [feed_id] => 86865891 [category_id] => 1 [feed_title] => Brand-new premium single-screen theatre opens in Hyderabad today [feed_description] => Hyderabads love affair with cinema shows no signs of slowing down. From packed multiplexes to iconic single screens that continue to hold a special place in the hearts of moviegoers, the citys theatre culture is witnessing an interesting revival. Adding to this growing excitement, Hyderabad has welcomed yet another revamped single-screen theatre today. Mythri Shiva Get the latest updates in Hyderabad City News , Technology , Entertainment , Sports , Politics and Top Stories on WhatsApp & Telegram by subscribing to our channels. You can also download our app for Android and iOS . [provider_name] => The Siasat Daily [provider_slugname] => siasat [source_icon] => source_logo/siasat.png ) [85] => Array ( [image_path] => entertainment/ [image_id] => 7173318 [name] => 599299005nani-on-cm-vijay-183554953-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/regional-cinema/story/cm-vijay-assembly-performance-nani-says-hes-rocking-the-show-2997402-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 11:09:40 [feed_source_id] => 7 [feed_id] => 86865957 [category_id] => 8 [feed_title] => CM Vijay is rocking in the Assembly: Actor Nani praises actor's political journey [feed_description] => CM Vijay is rocking in the Assembly: Actor Nani praises actor's political journey [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [86] => Array ( [image_path] => entertainment/ [image_id] => 7173307 [name] => 263310316msid-134326813,imgsize-66196.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/hollywood/news/in-2001-john-travolta-and-his-wife-kelly-preston-purchased-a-house-near-a-private-airport-to-park-their-jets-in-front-of-their-home/articleshow/134326672.cms [pub_date] => 2026-09-18 10:57:30 [feed_source_id] => 3 [feed_id] => 86865945 [category_id] => 8 [feed_title] => In 2001, John Travolta and his wife bought a house near an airport to park their jets [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [87] => Array ( [image_path] => entertainment/ [image_id] => 7173312 [name] => 23033383ranvediamdx-1789708826563_d.png [feed_url] => https://www.mid-day.com/entertainment/bollywood-news/article/ranveer-singh-pledges-to-support-education-of-1000-underprivileged-girls-23650614 [pub_date] => 2026-09-18 10:55:56 [feed_source_id] => 182 [feed_id] => 86865950 [category_id] => 8 [feed_title] => Ranveer Singh pledges to support education of 1,000 underprivileged girls [feed_description] => Ranveer Singh visited Lalbaugcha Raja on Ganesh Chaturthi, seeking blessings for his family. He pledged to join the Seva Sankalp Abhiyan and support the education of 1,000 underprivileged girls [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [88] => Array ( [image_path] => entertainment/ [image_id] => 7173308 [name] => 783938640msid-134326743,imgsize-509587.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/malayalam/movies/news/its-a-medical-miracle-x-review-sangeeth-prathap-sharaf-u-dheen-starrer-gets-praise-after-uae-premiere/articleshow/134326690.cms [pub_date] => 2026-09-18 10:51:43 [feed_source_id] => 3 [feed_id] => 86865946 [category_id] => 8 [feed_title] => 'Its A Medical Miracle' X review [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [89] => Array ( [image_path] => entertainment/ [image_id] => 7173309 [name] => 1903038966msid-134326712,imgsize-147854.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/tamil/movies/news/you-were-my-cinema-school-kamal-haasan-praises-modha-rathiri-director-raja-karuppasamy-leaving-him-emotional/articleshow/134326667.cms [pub_date] => 2026-09-18 10:49:34 [feed_source_id] => 3 [feed_id] => 86865947 [category_id] => 8 [feed_title] => Kamal Haasan praises 'Modha Rathiri' director Raja Karuppasamy [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [90] => Array ( [image_path] => entertainment/ [image_id] => 7173310 [name] => 533380985msid-134326656,imgsize-38232.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/music/news/zara-larsson-calls-out-us-president-donald-trumps-administration-for-unofficial-song-usage-this-video-is-so-dehumanising-/articleshow/134326607.cms [pub_date] => 2026-09-18 10:46:21 [feed_source_id] => 3 [feed_id] => 86865948 [category_id] => 8 [feed_title] => Zara Larsson calls out the Trump administration over unauthorized use of Midnight Sun' [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [91] => Array ( [image_path] => entertainment/ [image_id] => 7173319 [name] => 288906117vibe-181638372-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/reviews/story/vibe-review-kunal-kemmu-sparsh-shrivastava-preity-zinta-spy-comedy-2997399-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 10:45:09 [feed_source_id] => 7 [feed_id] => 86865958 [category_id] => 8 [feed_title] => Vibe review: Kunal Kemmu's spy comedy is chaotic, charming and occasionally too much [feed_description] => Vibe review: Kunal Kemmu's spy comedy is chaotic, charming and occasionally too much [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [92] => Array ( [image_path] => topnews/ [image_id] => 7173129 [name] => 153314144Performance20of20Care-Tharsis20Photo20Credit-20Special20Arrangement.jpeg [feed_url] => https://www.thehindu.com/entertainment/theatre/first-drop-theatres-care-tharsis-provides-caregivers-with-a-platform-for-their-stories/article71471382.ece [pub_date] => 2026-09-18 10:23:46 [feed_source_id] => 28 [feed_id] => 86865682 [category_id] => 1 [feed_title] => First Drop Theatres Care-Tharsis provides caregivers with a platform for their stories [feed_description] => First Drop Theatre celebrates its tenth anniversary with a playback theatre enactment of caregiver stories [provider_name] => The Hindu [provider_slugname] => thehindu [source_icon] => source_logo/thehindu.jpg ) [93] => Array ( [image_path] => entertainment/ [image_id] => 7173320 [name] => 1333485226prithviraj-sukumaran-on-writers-18261498-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/regional-cinema/story/prithviraj-sukumaran-says-writers-hold-power-in-malayalam-cinema-2997366-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 10:23:45 [feed_source_id] => 7 [feed_id] => 86865959 [category_id] => 8 [feed_title] => Prithviraj's crash-course on why writers hold the power in Malayalam cinema [feed_description] => Prithviraj's crash-course on why writers hold the power in Malayalam cinema [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [94] => Array ( [image_path] => entertainment/ [image_id] => 7173321 [name] => 727725047salman-khan-184732583-16x9_0.jpg [feed_url] => https://www.indiatoday.in/movies/celebrities/story/salman-khan-young-fan-video-child-pushed-mumbai-ganpati-event-2997374-2026-09-18?utm_source=rss [pub_date] => 2026-09-18 10:21:42 [feed_source_id] => 7 [feed_id] => 86865960 [category_id] => 8 [feed_title] => Salman Khan stops to comfort young fan after push at Ganpati event. Watch [feed_description] => Salman Khan stops to comfort young fan after push at Ganpati event. Watch [provider_name] => India Today [provider_slugname] => indiatoday [source_icon] => source_logo/India today logo.jpg ) [95] => Array ( [image_path] => topnews/ [image_id] => 7173123 [name] => 1798496559salman-modi.jpg [feed_url] => https://www.siasat.com/salman-khan-wishes-pm-modi-calls-him-narendra-bhai-3544023/ [pub_date] => 2026-09-18 10:21:24 [feed_source_id] => 418 [feed_id] => 86865670 [category_id] => 1 [feed_title] => Salman Khan wishes PM Modi, calls him [feed_description] => Mumbai: Bollywood superstar Salman Khan extended birthday wishes to Prime Minister Narendra Modi as he turned 76 on Thursday. In his message, the Sultan actor warmly addressed him as Narendra Bhai. Taking to his X handle (formerly known as Twitter), Salman shared a special greeting for the Prime Minister, writing, Janam Din Mubarak Ho Honourable Get the latest updates in Hyderabad City News , Technology , Entertainment , Sports , Politics and Top Stories on WhatsApp & Telegram by subscribing to our channels. You can also download our app for Android and iOS . [provider_name] => The Siasat Daily [provider_slugname] => siasat [source_icon] => source_logo/siasat.png ) [96] => Array ( [image_path] => entertainment/ [image_id] => 7173313 [name] => 1840694370raveena-karsima-1789701408977_d.png [feed_url] => https://www.mid-day.com/entertainment/television-news/article/andaz-apna-apna-raveena-tandon-reveals-how-she-bonded-with-karisma-kapoor-23650595 [pub_date] => 2026-09-18 10:18:35 [feed_source_id] => 182 [feed_id] => 86865952 [category_id] => 8 [feed_title] => Andaz Apna Apna: Raveena Tandon reveals how she bonded with Karisma Kapoor [feed_description] => Raveena Tandon recalled her equation with Karisma Kapoor on Andaz Apna Apna, revealing how they often laughed despite their differences. She shared how being tied to a pillar during a night shoot helped break the ice [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [97] => Array ( [image_path] => entertainment/ [image_id] => 7173311 [name] => 970828459msid-134326019,imgsize-100014.cms [feed_url] => https://timesofindia.indiatimes.com/entertainment/english/hollywood/news/after-taylor-swift-travis-kelce-wedding-tom-cruise-joins-kelce-brothers-on-new-heights-podcast-watch/articleshow/134325610.cms [pub_date] => 2026-09-18 10:17:00 [feed_source_id] => 3 [feed_id] => 86865949 [category_id] => 8 [feed_title] => Tom Cruise joins Travis Kelce on podcast - WATCH [feed_description] => [provider_name] => The Times of India [provider_slugname] => timesofIndia [source_icon] => source_logo/TimesofIndia.jpg ) [98] => Array ( [image_path] => entertainment/ [image_id] => 7173314 [name] => 1435119177Ajith-Kumar-y-1789697439731_d.png [feed_url] => https://www.mid-day.com/entertainment/regional-indian-cinema-news/article/ajith-kumars-first-look-from-dare-devil-out-shooting-to-begin-in-november-23650585 [pub_date] => 2026-09-18 10:14:13 [feed_source_id] => 182 [feed_id] => 86865953 [category_id] => 8 [feed_title] => Ajith Kumars Dare Devil first look unveiled, shooting to begin in November 2026 [feed_description] => Ajith Kumars Dare Devil first look has been unveiled, showing the actor in a white suit, red-tinted sunglasses and holding a dice piece. Directed by Adhik Ravichandran, the film will begin shooting in November 2026 [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) [99] => Array ( [image_path] => entertainment/ [image_id] => 7173315 [name] => 2110382679samatha-1789701041022_d.png [feed_url] => https://www.mid-day.com/entertainment/regional-indian-cinema-news/article/samantha-ruth-prabhu-heads-to-chennai-to-shoot-celebrity-masterchef-tamil-23650593 [pub_date] => 2026-09-18 10:03:00 [feed_source_id] => 182 [feed_id] => 86865954 [category_id] => 8 [feed_title] => Samantha Ruth Prabhu starts shooting for Celebrity MasterChef Tamil [feed_description] => Samantha Ruth Prabhu has started shooting for the culinary reality show Celebrity MasterChef Tamil in Chennai. The actress, who is reportedly in her seventh month of pregnancy, is set to take on a new challenge with the show [provider_name] => Mid Day [provider_slugname] => midday [source_icon] => source_logo/mid-day.jpg ) )